KEGG   Rattus norvegicus (rat): 405319Help
Entry
405319            CDS       T01003                                 

Gene name
Olr1200
Definition
(RefSeq) olfactory receptor 1200
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405319 (Olr1200)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405319 (Olr1200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 405319
NCBI-ProteinID: NP_001000966
RGD: 1333920
Ensembl: ENSRNOG00000051184
Vega: OTTRNOG00000001061
UniProt: A0A096MJG2
Position
8q21
AA seq 311 aa AA seqDB search
MTAENTSSVAEFILVGLTDQPDLQIPLFILFLGFYMVTLVGNLGLITLIGLNSHLHIPMY
FFLLNLSFIDFSYSTTLTPKMLVGFVVRKNIISYAGCMTQFFFFCFFVFSESYILSAMAY
DRYVAICKPLLYRVTMSPQVCSFLLSGVYGMGVFGAVAHMGNLQFITFCADNIINHYMCD
IIPLLELSCNSSYINLLVVFIVVTIGIGVPIVTIFISYGFILSSILHISSKEGRSKAFST
CTSHIIVVSLFFGSGAFMYLKPPSSLPLDQGKVSSVFYTAVVPMFNPLIYSLRNKDVKIA
LKKTLSRKNFS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagagaacacctcctcggtggcagagttcatccttgttggattaacagaccag
cctgacctccagatcccactcttcatcctctttctcggtttctacatggtcactctggtg
gggaacctgggcttgatcacactgatagggttgaactctcacctgcatattcccatgtac
tttttcctcctcaacttgtccttcatagatttcagttactctactacacttacccctaaa
atgctggtgggctttgttgtgaggaagaacatcatctcctacgcagggtgtatgactcag
ttcttcttcttctgtttctttgtcttttctgagtcctacatcttgtcggcaatggcatac
gaccgctatgttgccatctgtaaaccattgttgtatagggtcaccatgtctccccaagtg
tgctcattccttttgtcaggcgtctatgggatgggggtttttggggctgtggcccatatg
ggaaacttacagtttataaccttctgtgctgacaacatcattaaccactatatgtgtgac
atcattcccctccttgagctgtcctgcaatagctcttacatcaatttgttggtggttttt
attgttgtaaccattggcattggagtacccattgttaccatttttatatcttatggcttc
atcctctctagcattctccacattagttccaaggaaggcaggtccaaagcctttagtacc
tgcacttctcatattattgtagtgtctctcttttttgggtcaggagcttttatgtatctc
aaaccaccttctagtttgcctctggatcagggaaaagtgtcctctgttttctatactgct
gtagtgcccatgttcaatccattaatctatagcctgaggaataaggatgtcaaaattgct
ctgaagaaaaccttgagcagaaaaaatttctcttaa

DBGET integrated database retrieval system