KEGG   Rattus norvegicus (rat): 405372Help
Entry
405372            CDS       T01003                                 

Gene name
Olr801
Definition
(RefSeq) olfactory receptor 801
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405372 (Olr801)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405372 (Olr801)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405372 (Olr801)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 405372
NCBI-ProteinID: NP_001001004
RGD: 1334194
Ensembl: ENSRNOG00000061052
UniProt: D3ZW97
Position
4q24
AA seq 313 aa AA seqDB search
MKKDNATWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMY
FFLCHLSVVDICYTSSGAPQMLAHFLMEKKTISFALCGTQHFFALALGGTEFLLLAAMAY
DRYVAVCDPLRYTVVMSPRLCMGLAGVSWFVGLVNSAVETAVTMRLPTCGHNVLNHVACE
TLALVRLACVDITLNQVVILASSVVVLLVPCCLVSLSYAHIVAAIIKIRSTQGRRKAFGT
CASHLTVVSMSYGMALFTHMEPTSTASAEQDKVVVVFYAVVTPMLNPLIYSLRNKDVKAA
FSRVLMKSFESKN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagacaatgcaacctgggtaagtgagtttatcctcatgggtctctccagtgac
aaacacatccaagctggactctttgtcctctttggggtcacctacctgctgactctgctg
ggcaatgggctcattgtcctgctcattgcactggacccacgactccacctgcccatgtac
ttcttcctctgtcacctgtcagtggtagacatctgctatacctccagtggggccccccag
atgctggcacacttcctcatggagaagaagaccatctcttttgctctatgtgggacccaa
cacttcttcgctctggccctaggaggaactgagttcttgctgctggctgccatggcctat
gaccgctatgtggctgtctgtgatccactacggtacacagtggtgatgagcccaaggctc
tgcatgggtctagcaggcgtctcttggtttgtgggtttagttaattctgctgtggagaca
gcggtcaccatgcgccttcctacctgtgggcacaacgtgctcaaccatgtggcctgcgag
acactggcactggtcaggttggcctgtgtggacatcaccctcaaccaagtggtgattctg
gcctctagtgtggtggtgctgctggtgccctgctgcctggtctctctgtcctatgcccac
attgtggctgccatcataaagatccgctctacccagggacgccgcaaagcctttggtact
tgtgcttcccacttaactgtggtctctatgtcttatgggatggcccttttcacacatatg
gagcccacctccacagcttctgctgagcaagacaaggtggtggtggtcttctatgctgtg
gtcaccccaatgctgaatcctctcatctacagcctgaggaacaaggatgtgaaagccgcc
ttcagtcgagttctgatgaagagttttgagtcaaagaattag

DBGET integrated database retrieval system