KEGG   Rattus norvegicus (rat): 405915Help
Entry
405915            CDS       T01003                                 

Gene name
Olr175
Definition
(RefSeq) olfactory receptor 175
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405915 (Olr175)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405915 (Olr175)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405915 (Olr175)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 405915
NCBI-ProteinID: NP_001001029
RGD: 1332599
Ensembl: ENSRNOG00000051953
UniProt: D4A2S0
Position
1
AA seq 321 aa AA seqDB search
MSGANSSSLTPEFFILNGIPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIVHEEALHRP
MYYFLTLLSFTDITLCTTTVPNMLCIFWFNLKKIGFKACLAQMFFVHTFTATESGMLMLM
ALDRYVAICYPLRYGTILTNPVIAKASLATFLRSVSFILPFTFLTKRLPYCRGNLIPHAY
CDHMSVAKISCGNVKVNAVYGLLVALVVCAFDIFCITVSYTMILRAVMNLSSADARHKAF
STCTSHICAIVITYVPAFFNFFTHRFGGHTIPHHIHIIVANLYLLLPATMNPIVYGVKTK
QIRESVIKYFSGDKSGIADIK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagccaacagctccagcctgaccccagaattctttatcttgaacggtattccc
gggctggaagatgcacatgtctggatctcactgccattctgcttcatgtacatgattgct
gtggtggggaactgtgggcttatctacctcattgtccatgaggaggctctgcaccggccc
atgtattattttctaaccctgctctccttcactgacataactttatgtaccactactgta
cccaatatgctgtgtatattctggttcaacctcaagaagattggatttaaagcttgcctg
gcccagatgttctttgtgcataccttcacagcaacagagtctggcatgctaatgctcatg
gccctggatcgctatgtggccatctgctaccctttgcgctatgggaccatcctgaccaat
cctgtgattgccaaagctagtcttgctactttcttgaggagtgtgtcattcatcctccct
tttaccttcctcaccaagcgcctgccctattgccgaggaaacctcatcccccatgcctac
tgtgaccacatgtctgtggctaagatatcctgtggcaacgtcaaagttaatgcagtctat
ggtctgttggttgctcttgtggtttgtgcatttgacatattctgtatcactgtgtcatac
acaatgatattgagagcagtaatgaacctgtcctctgctgatgctcgtcacaaggccttc
agcacctgcacatctcacatctgtgctattgtgatcacttatgtgcctgccttttttaac
ttcttcactcatcgttttggaggacacacaattccacaccacattcacatcatagtggct
aacctctacctgctactgcctgctaccatgaacccaattgtttatggagtcaagaccaag
cagattcgggagagtgtgatcaaatattttagtggagacaagagcggcattgctgatata
aaatga

DBGET integrated database retrieval system