KEGG   Rattus norvegicus (rat): 405917Help
Entry
405917            CDS       T01003                                 

Gene name
Olr186
Definition
(RefSeq) olfactory receptor 186
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405917 (Olr186)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405917 (Olr186)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 405917
NCBI-ProteinID: NP_001001031
RGD: 1332760
Ensembl: ENSRNOG00000049981
UniProt: D3ZXV7
Position
1q32
AA seq 313 aa AA seqDB search
MLHSNKTQFHPSSFLLIGIPGLEDLHLWIGFPFFAAYLIAVLGNTIILFVIQTEHSLHQP
MFYFLAMLACTDLGLSTATIPKMLGIFWFNLGEITFGACITQMYTIHLCTGLESVVLTVM
AIDRYIAICNPLRYSMILTNKVIAILGVVIIVRTLVFATPFIFLIFRLPFCGVRIVPHTY
CEHMGLAKLACANIRVNVIYGLVAFSVGYIDLSVIGFSYIRILQAVFRLPSWDARLKALS
TCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVVRMLNPKMH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattccaacaagacacagttccacccttcctccttcctcctgatagggatccca
gggctggaagatttgcacctttggatcggctttcccttctttgcagcgtatctgatagcc
gtcttggggaacaccatcatcttatttgtgatccaaactgaacacagcctccaccaacct
atgttctactttctggccatgttggcatgcaccgatttgggtttatccacagccaccatc
cccaagatgctgggcattttctggttcaatctcggggagattacatttggagcctgcatc
actcagatgtataccatccacctatgcaccggcctggaatctgtggtgctgacagttatg
gccatagatcgttatattgctatatgtaacccactgaggtacagcatgatcctcaccaac
aaggtgatagctattctgggtgtagtcatcatagtcaggactttggtgtttgccactcca
tttatatttctcatctttaggttgcctttctgtggtgtccgaattgtcccacatacctac
tgtgaacacatgggtttggcaaagctagcttgtgctaatatcagggtcaatgttatctat
ggattggttgctttctcagtgggatacattgatctatctgtgattggattttcctacatc
cggattctccaagcagtcttccgccttccatcctgggatgctcggcttaaggcacttagc
acatgtggctcccatgtgagtgtcatgttggccttttacctgccagctctcttctcattc
atgacacaccgctttggccacaacatccctcactatatccacatacttctagccaatctg
tatgtggtcgttcctcctgccctgaaccctgttatctatggagtcaggacaaaacagata
agggagagagtagtaagaatgcttaaccctaagatgcactga

DBGET integrated database retrieval system