KEGG   Rattus norvegicus (rat): 405923Help
Entry
405923            CDS       T01003                                 

Gene name
Olr250
Definition
(RefSeq) olfactory receptor 250
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405923 (Olr250)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405923 (Olr250)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405923 (Olr250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 405923
NCBI-ProteinID: NP_001001037
RGD: 1334370
Ensembl: ENSRNOG00000028802
UniProt: D4A403
Position
1q33
AA seq 315 aa AA seqDB search
MAFLQDGNYTAVTEFILLGLTDDPVLRIVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH
PMYFFLSHLASVDIGISSSVTPNMLVNFLLDRNSISYIGCGIQLGSADFIASVECFLLAA
MAYDRFMAICNPLLYSAKMSTQVCIQLVVGSYTGGFFNASLIVMVYFFSFLFCGPNIVDH
FFCDFAPLVELSCSDVSDSVLLISFSAGSVTIITVFIIAVSYSYILITILKIHSTEGRHK
AFSTCTSHLTAVTLYYGTVTFIYVMPKSNYSTDQNKVVSVFYMVVVPMLNPLIYSLSNNE
IKGALKRQLGMKTVS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctgcaggatgggaactacactgcagtgacagagttcattttattgggatta
actgatgacccagtcctcagaattgtcctcttcaccattatcctgtgtatctacctggtg
actgtttctggaaacctcagcaccatccttctcatcagagtctcttcccagcttcatcat
cccatgtacttttttctcagtcacttggcttctgttgacataggcatttcatcttctgtc
acacccaatatgcttgtcaacttcttattggacagaaatagtatctcctatattggatgt
ggcatccagcttggttcagctgatttcattgcatcagttgaatgctttcttctggctgct
atggcttatgatcgcttcatggcaatctgcaacccactgctttattccgccaaaatgtcc
acacaagtctgtatccagctggttgtgggatcttatacagggggtttttttaatgcttcc
ctaattgtaatggtttactttttttcttttctcttctgtggaccaaatatagttgatcat
tttttctgtgattttgctcctttagtggaactctcctgttctgatgtcagtgactctgta
cttcttatctcattttctgctggctcagtcactattatcacagtgttcatcatagccgtt
tcctattcctatatcctcatcaccatcctgaagatacactccactgagggtcgccataag
gccttctccacatgcacctcccatctcactgcagtcactctctactatggaactgtcacc
ttcatttatgtgatgcccaagtctaactattctactgatcagaacaaggtggtgtctgtg
ttctacatggtggtggtccccatgttgaacccgctcatctacagtctcagcaacaatgag
attaaaggtgctctgaagagacagcttggtatgaaaacagtttcttag

DBGET integrated database retrieval system