KEGG   Rattus norvegicus (rat): 405955Help
Entry
405955            CDS       T01003                                 

Gene name
Olr720
Definition
(RefSeq) olfactory receptor 720
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405955 (Olr720)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405955 (Olr720)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405955 (Olr720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 405955
NCBI-ProteinID: NP_001001067
RGD: 1333140
Ensembl: ENSRNOG00000006637
UniProt: D3Z963
Position
3q24
AA seq 309 aa AA seqDB search
MEPKNNVTYFVLLGLSQNPKVQKGLFVLFLLSYILTMVGNMLIVMTVTISNSLGSPMYFF
LASLSFVDIIYSSAISPKLISDLFFSQNTISFKFCMTQLFTEHFFGGSEVFLLLVMAYDR
YVAICKPLHYSTIMKQWVCVVLLILSWIGGFLHSVIQLSTIYGLPFCGPNVIDHFMCDMY
PLLKLVCIDTYAIGLLVMANGGLICTVVFLLLLISYGVILYSLKSLNQEGRWKALSTCGS
HITVVVSFFVPCIFMYARPAKTFPIDKLLSVFYTVITPMMNPLIYTLRNSEMTNAMKKLW
RRKVISGHK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaagaacaatgtaacctactttgtcctcttgggcctctcacagaatccaaag
gtgcagaaaggactctttgttcttttcttgctttcctatattctgaccatggtgggaaat
atgctcattgttatgactgtaaccatcagtaacagcttgggctcaccaatgtatttcttt
cttgctagcttgtcatttgtggatatcatttattcatccgccatttctcccaaattgatt
tcagatttgttcttcagccaaaacacaatatcctttaaattttgtatgactcagctcttc
acagaacacttttttggtggttcagaggtttttcttctgttggtgatggcctatgatcgt
tacgtggccatctgtaagcccttgcattattcaactatcatgaagcaatgggtttgtgtt
gtgctgttgatattatcttggattggaggatttttgcactcagtgattcagctcagcact
atatatggactaccattctgtggtcctaatgtcattgatcattttatgtgtgacatgtac
cccttactaaaacttgtttgtattgacacctatgccattggcctcttagtgatggccaat
ggagggctgatctgcacggttgtgtttctactcttactcatctcttatggtgtcatcttg
tactctctaaagagccttaatcaggaagggaggtggaaagctctctctacctgtggctcc
cacatcactgtagttgtttcattctttgttccctgtattttcatgtatgcacgacctgct
aaaactttccccattgacaaattgttgagtgtgttttatacagtcattacccccatgatg
aaccccttgatatatactctgagaaactcagagatgacaaatgctatgaagaagctgtgg
agaagaaaagttatttcaggacacaaataa

DBGET integrated database retrieval system