KEGG   Rattus norvegicus (rat): 405988Help
Entry
405988            CDS       T01003                                 

Gene name
Olr1397
Definition
(RefSeq) olfactory receptor 1397
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405988 (Olr1397)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405988 (Olr1397)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srbc 7TM_GPCR_Srv 7TM_GPCR_Srx SLC3A2_N Reo_P9
Motif
Other DBs
NCBI-GeneID: 405988
NCBI-ProteinID: NP_001001094
RGD: 1334139
Ensembl: ENSRNOG00000029739
UniProt: D3ZZZ6
Position
10q21
AA seq 310 aa AA seqDB search
MRSFNLSLEGFLLVGFSDWPRLELILLVLLSIFYSLTLCGNITIIVLTQQDLQLQTPMYF
FLAHLSFLDLCFTSSTVPQLLISLSQSDQMISYAGCMTQLFIALLLGGAECVLLVVMAFD
RYVAVCRPLHYTSIMHPLLCHTLAISSWVGGLVNSLTQTSLIMTIPLCGHHLNHFFCEML
VLLKLACGDTGGTEADLFVAGAIILVCPVALILGTYAHIAHAVLKIKSRAGRRKALGTCG
SHLTVVSLFYGSAMYTYLQPVHMYSGSEGKFAALFYTIVTPMLNPLIYTLRNKDVKGALC
KVLRKGRDKE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtttcaatctcagcttagaaggtttcctgttggtaggcttctcagattggcct
cgactggaacttatcctgctggtcctcctttcaattttctactctctaaccctctgtggc
aacatcaccattattgttctcactcaacaggaccttcagctgcaaacacccatgtacttc
ttccttgcccacctctccttcctggacctctgtttcaccagtagcactgtgccccagctt
ctaatcagtctttcccaaagtgatcagatgatcagctatgctgggtgcatgacccagttg
ttcatagcgctcttactgggtggagctgagtgtgtcctccttgtggtgatggctttcgac
cgctatgtcgctgtgtgtcgtccactacactacaccagcattatgcaccctcttctctgc
cacacattggccatctcctcctgggtgggaggccttgtgaactctctgactcagacaagc
ctcatcatgaccatacctctctgtggccatcacctgaaccacttcttctgtgagatgctt
gttctcctgaagctggcttgtggggacacagggggaacagaggctgacttgtttgtggca
ggggctataattttggtctgtcctgtagcactaattctaggcacctatgcacacattgcc
catgcggtgctgaagatcaagtcaagagctgggcgcagaaaggctctggggacttgtggg
tcccaccttactgtggtttccctcttttatggctcagccatgtacacgtatctccaacct
gtccacatgtattctgggagtgaaggaaagttcgctgccctcttttataccatagttact
cctatgctgaaccctctgatttataccctaaggaacaaggatgtgaaaggggctctgtgc
aaggtacttagaaaaggaagagacaaagaatag

DBGET integrated database retrieval system