KEGG   Rattus norvegicus (rat): 405994
Entry
405994            CDS       T01003                                 

Gene name
Olr1515
Definition
(RefSeq) olfactory receptor 1515
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405994 (Olr1515)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405994 (Olr1515)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405994 (Olr1515)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 405994
NCBI-ProteinID: NP_001001098
RGD: 1332804
Ensembl: ENSRNOG00000048395
UniProt: D3ZPY5
Position
10q24
AA seq 323 aa
MARGNQTSTFEFLLWGLSEKPHQQYILFLIFLWMYLVIVAGNLLIVLAISTDVRLHTPMY
FFLASLSCVDILFTSTTVPKALVNIHTQSRTISYAGCLVQLYFFLTFGDMDIFLLATMAY
DRFVAICHPLHYTMIMSFQRCSLLVITCWTFTNLVAMTHTFLIFRLSFCSKKVIPDFFCD
LGPLMKIACSETHINELVLLFLGGAVILIPFLLILVSYIRIVTAILRVPSAQGRRKAFST
CGSHLSVVALCFGTVIRAYLCPSSSSSNSVVEDTAAAVMYTVVTPLLNPFIYSLRNKDMK
GALVRILKGKISFSWAQGLLQRR
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcaagagggaaccagaccagcacctttgaattcctcctttggggactgtcagagaag
ccacatcaacaatacattctcttcctgatcttcctgtggatgtatctggtcattgtagct
gggaatctgctcattgtcctggcaattagtactgacgttcgactccacacccccatgtac
ttcttccttgccagcctgtcctgtgttgacatccttttcacctccaccacagtacccaag
gccctggtgaacatccacacccaaagcaggaccatctcctatgcaggatgcctggtccag
ctctattttttcttgacctttggagacatggacatcttcctcctggccacaatggcctat
gatcgctttgtggccatttgtcaccctctccactatacgatgatcatgagcttccagcgc
tgctcactcttggtgataacctgttggacctttacaaaccttgttgccatgacacacacc
tttctcatattccggctctccttctgctctaagaaggtcattccagacttcttctgtgac
ctgggacccctgatgaagattgcttgctctgaaacccatatcaatgagcttgtgcttctc
ttcctggggggtgcagtcatcttaatcccctttttgctcatcctggtgtcttatatccgc
attgtaacagctatcctcagggtcccttctgcccaggggagacgcaaggccttttctacc
tgtgggtcacacctttctgtggtggccctgtgctttgggacagtaataagggcttatctg
tgtccctcatcctcttcctctaactcagtggtagaggacacagcagctgctgtcatgtat
acagtggtgactcccctgctgaaccccttcatttatagcctaagaaacaaagacatgaag
ggagcactggtcagaattctcaagggcaaaatctccttctcctgggcccagggacttctg
cagagaaggtga

DBGET integrated database retrieval system