KEGG   Rattus norvegicus (rat): 405999Help
Entry
405999            CDS       T01003                                 

Gene name
Olr1532
Definition
(RefSeq) olfactory receptor 1532
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405999 (Olr1532)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405999 (Olr1532)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 405999
NCBI-ProteinID: NP_001001103
RGD: 1333081
Ensembl: ENSRNOG00000045748
UniProt: M0R9P2
Position
11q12
AA seq 305 aa AA seqDB search
MGGNSTLLTEFVLRGITDRPELQVPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMYL
FLGNLAFADACTSSSVTPKMLMKFLYRNDMISIGECFAQFYFFCFSATTEIFLLVAMAYD
RYVAICNPLLYLVVMSKRLCTVLISMSYIIGFLNPIVHVGLLFRLTFCRSNVIDHFYCEI
MPLYVISCTDPSLNGLVAFIFASSIQISTSVTIVVSYARVLFAVLNMKSEKGRRKAFFTC
SAHLLSVSLFYDTLLFMYVSPGSGSGKQKDKMYSLFYTVVIPLLNPFIYSLRNKEVLGAL
KKLIK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaaacagcaccctgctgactgagtttgttctcagaggaataacagatcgtcca
gagctgcaagtccccctgttcctggtgttcttcctcatctatgtcaccaccatggtgggc
aaccttggcttaatctttctcatctggaaggacccccatcttcacacacccatgtacctt
ttccttggaaatttagcctttgctgatgcctgcacttcatcctctgtgacacccaagatg
cttatgaaatttttatataggaatgatatgatatccataggtgagtgctttgcccagttt
tattttttttgtttcagcgcgaccacagaaattttcctcctggtagccatggcctatgac
cggtatgtagccatatgtaatcctctgctctatcttgtggtgatgtccaaaagactctgc
actgtgctaatcagtatgtcatatattattggttttctaaaccctatagttcatgtggga
ttattattcagattaacgttctgtaggtctaatgttattgaccatttctactgtgaaatc
atgccactctacgtaatttcttgcacagatccatctcttaatggattggtggcttttatt
tttgcttcttccatacaaatcagtacctctgtgaccattgtagtctcttatgcccgtgtc
ctatttgctgtcctgaacatgaagtctgagaagggcagaagaaaagctttcttcacctgc
agtgcccacctgctctctgtctctttgttctatgatactctcctcttcatgtatgtgagc
cctgggtctgggtcaggtaaacagaaggataaaatgtattctctgttctatacagttgtg
attcctctgctaaacccctttatttacagcttaagaaacaaagaagttttgggtgctctg
aagaaactcataaaatga

DBGET integrated database retrieval system