KEGG   Rattus norvegicus (rat): 406230
Entry
406230            CDS       T01003                                 

Gene name
Rpp21
Definition
(RefSeq) ribonuclease P protein subunit p21
  KO
K03540  ribonuclease P protein subunit RPR2 [EC:3.1.26.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    406230 (Rpp21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    406230 (Rpp21)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     406230 (Rpp21)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    406230 (Rpp21)
SSDB
Motif
Pfam: Rpr2
Other DBs
NCBI-GeneID: 406230
NCBI-ProteinID: NP_001002831
RGD: 1303090
Ensembl: ENSRNOG00000000786
Vega: OTTRNOG00000001485
UniProt: Q6MFZ6
Position
20
AA seq 150 aa
MAGQVKDREAFQRLNFLYQAAHCVLSQNPENQALARFYCHTEKTIAKRLVLRQDPSVKRT
LCRDCSSLLIPGLTCTQRQRRRKGQRWTVQTCLTCQRSQRFLNDPKHLLWGDRPEAQLEN
QADFKPSEPLPNIADLSKENVQTQALNTTE
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcgggccaagtgaaagaccgggaggccttccagagactcaacttcctttaccaggct
gcacactgcgtcctctctcagaaccccgagaaccaggcactggctaggttttactgccac
acagagaagaccatcgcgaagcggctggtcctacggcaggacccctctgtgaagaggacg
ctctgtcgcgactgctcctctctcctcatccctggcctcacctgcacgcagcgccagaga
cgccgaaagggacaacgctggacagtacagacctgtctgacatgccagcgaagccagcgg
ttcctcaatgaccccaagcatctcctctggggtgaccggcctgaagcccagttggaaaat
caggcggatttcaaaccgtcagagcccctgccaaacatagctgacctttctaaggagaac
gtgcagactcaggctttaaacaccactgaatga

DBGET integrated database retrieval system