KEGG   Rattus norvegicus (rat): 406867
Entry
406867            CDS       T01003                                 

Gene name
Ly6g5b
Definition
(RefSeq) lymphocyte antigen 6 complex, locus G5B
  KO
K20005  lymphocyte antigen 6 complex locus protein G5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    406867 (Ly6g5b)
SSDB
Motif
Pfam: Activin_recp
Other DBs
NCBI-GeneID: 406867
NCBI-ProteinID: NP_001001934
RGD: 1303101
Ensembl: ENSRNOG00000027516
Vega: OTTRNOG00000000291
UniProt: Q6MG53 N0E642
Position
20p12
AA seq 194 aa
MRACVLVHVLTMVGFALGKAPVASVRTCHLCFLEDPSIGCISGSEKCTISSSSPCMVITI
YQNVKVRFHVRGCGQHHSFRCQENHVIYYSDYWYRVNCCQYDYCNSWSSAQHQSTLPGPP
GNHLGVPLSESQIKQFYQALHLPLFQPDLHTHKVSEGPDSLILPPGLGLSIADLRKIYLF
LNSSGLLVLPQARP
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagggcctgtgtgcttgtccatgtgctgaccatggtgggctttgccttggggaaggct
ccggtcgccagcgtccgtacctgccacctgtgcttcttagaagacccttcgataggctgc
atttctgggtcagaaaagtgcaccatcagctcttcctcgccatgcatggtgatcaccatc
tatcagaatgttaaggttcgcttccacgtacggggctgtggacagcaccactccttccgg
tgtcaagaaaatcacgtcatctactactcagactactggtatagggttaattgctgccag
tatgattactgcaactcctggtccagtgcccagcaccagagcactctgcctgggccccca
ggaaaccatctgggtgtgcccctctctgagtctcagataaaacagttctaccaggccctg
cacctccctctgtttcagcctgacctccacactcataaggtgtctgagggcccggactct
ctcattctgcccccggggctgggcttgtccattgccgacctgcgcaaaatatacttgttc
ctcaacagttcaggacttctggttcttccccaggctagaccctga

DBGET integrated database retrieval system