KEGG   Rattus norvegicus (rat): 407765
Entry
407765            CDS       T01003                                 

Gene name
St6galnac6
Definition
(RefSeq) alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  KO
K03376  N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7F) [EC:2.4.99.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    407765 (St6galnac6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    407765 (St6galnac6)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     407765 (St6galnac6)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   407765 (St6galnac6)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 407765
NCBI-ProteinID: NP_001015036
RGD: 1303196
Ensembl: ENSRNOG00000046984
UniProt: Q5BJS3
Position
3
AA seq 199 aa
MNDAPTTGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQG
SLLRVIQRAGLAFPNMEAYAVSQARMQQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVE
LCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKR
VFSSWAQLYGITFSHPSWT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaacgatgctcccaccactggctactcggccgacgtcggcaacaaaaccaccttccgc
gtagtggctcattccagtgtgttccgggtgctgcggaagccccaggaatttgtcaacagg
acccctgaaactgtgttcatcttctggggccccccaaacaagatgcagaagccccagggc
agcctcctgcgcgtcatccagcgggcgggccttgcgttccctaacatggaggcctatgcc
gtctctcaagcccgcatgcagcagtttgacgacctcttccggggtgagacaggcaaggac
agggaaaagtcccactcgtggttgagcacaggctggtttaccatggtgattgcggtggag
ttgtgtgaccatgtgcacgtgtatggcatggtccctcccgactactgcagccagcggccc
cgcctgcagcggatgccgtaccactactatgaacccaaggggccagatgaatgtgtcacc
tacatccagaacgagcacagccgtaagggcaatcaccaccgcttcatcactgagaagagg
gtcttctcatcctgggctcaactctacggtatcaccttctcccacccctcctggacctaa

DBGET integrated database retrieval system