KEGG   Rattus norvegicus (rat): 408199
Entry
408199            CDS       T01003                                 

Gene name
Sucnr1, Gpr91
Definition
(RefSeq) succinate receptor 1
  KO
K10042  succinate receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    408199 (Sucnr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    408199 (Sucnr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    408199 (Sucnr1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 408199
NCBI-ProteinID: NP_001001518
RGD: 1303193
Ensembl: ENSRNOG00000014039
UniProt: Q6IYF9
Structure
PDB: 
6RNK 6IBB

Position
2q31
AA seq 317 aa
MAQNLSCENWLALENILKKYYLSAFYGIEFIVGMLGNFTVVFGYLFCMKNWNSSNVYLFN
LSISDLAFLCTLPMLIRSYATGNWTYGDVLCISNRYVLHANLYTSILFLTFISIDRYLLM
KFPFREHILQKKEFAILISLAVWVLVTLEVLPMLTFITSTPIEKGDSCVDYASSGNPKYS
LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKKRSQQQATVLSLNKPLRLVVLAVVIFSVL
FTPYHIMRNVRIASRLDSWPQGCSQKAIKCLYILTRPLAFLNSAVNPIFYFLVGDHFRDM
LFSKLRQYFKSLTSFRL
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcacagaatttatcttgtgaaaattggctggcattagagaatattttgaaaaagtac
tacctctctgcattttatgggatcgagttcattgttggaatgcttggcaatttcaccgtg
gtgttcggctacctcttctgcatgaagaactggaacagtagcaacgtctatctcttcaac
ctttccatctctgaccttgctttcctgtgcacgcttcccatgctgataaggagttacgcc
actgggaactggacctatggagatgttctctgcataagcaaccgttatgtgcttcatgcc
aacctctacaccagcatccttttcctcactttcattagcatagaccgatatctgctcatg
aagttccctttccgagaacacattctacaaaagaaggaatttgccattttaatctccctg
gctgtctgggtcttagtgaccttagaagttctacctatgctcacgtttatcacttccacc
ccaatagaaaagggcgacagctgtgtcgactatgcaagttctggaaaccctaaatacagt
ctcatttacagcctgtgcctgactttgctgggcttcctcattcctctgtctgtaatgtgc
ttcttctactacaaaatggtagtcttcctaaagaagaggagccagcagcaggcaactgtg
ctatcgctgaacaaacctctgcgcctggtggtcctggcagtggtgatcttctctgtactc
tttacaccttaccatatcatgcgcaatgtgaggattgcctcacgcttggatagctggcca
cagggatgttcccagaaggccatcaaatgcttatacatcctgaccagacctctggccttt
ctgaacagtgctgtcaaccccatcttctacttccttgtgggagaccatttcagagacatg
ctgtttagtaagttgagacaatacttcaagtcccttacgtccttcaggctctga

DBGET integrated database retrieval system