KEGG   Rattus norvegicus (rat): 408201Help
Entry
408201            CDS       T01003                                 

Gene name
Ctsql2
Definition
(RefSeq) cathepsin Q-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 408201
NCBI-ProteinID: NP_001002813
RGD: 1303225
Ensembl: ENSRNOG00000048693
UniProt: Q4QRC2
Position
17p14
AA seq 343 aa AA seqDB search
MTAALFLIILCLGVVSGASAFNLSLDVQWQEWKMKYEKLYSPEEELLKRVVWEENVKKIE
LHNRENSLGKNTYIMEINNFADLTDEEFKDMITGITLPINNTMKSLWKRALGSPFPNSWY
WRDALPKSIDWRKEGYVTRVREQGKCKSCWAFPVAGAIEGQMFKKTGKLTPLSVQNLVDC
SKPQGNKGCRGGTTYNAFQYVLQNGGLESEATYPYKGKEGLCKYNPKNAYAKITRFVALP
EDEDVLMDALATKGPVAAGIHVVYSSLRFYKKGIYHEPKCNNRVNHAVLVVGYGFEGNET
DGNNYWLIKNSWGKQWGLKGYMKIAKDRNNHCGIATFAQYPIV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgctctcttcctgatcatcctgtgcttgggagttgtgtcaggtgcttcagca
tttaatctcagtttggatgtccaatggcaagaatggaagatgaaatatgaaaaattatac
agtccggaggaagaactcctgaagagagtggtatgggaagaaaatgtgaaaaagattgaa
ctgcataacagggagaattccttggggaagaatacctatattatggaaataaataatttt
gctgacctgactgatgaagaattcaaggacatgataactggtattacgttgccaattaac
aacacaatgaaaagtctctggaaacgtgcacttggtagtccttttcctaattcttggtat
tggcgagatgctttgcccaaatccattgattggagaaaggaaggctatgtgactcgtgtg
agggaacagggaaagtgtaagtcttgttgggcttttcctgtagctggtgccatagaagga
caaatgttcaagaaaacaggcaaactgaccccactgagtgtccagaatcttgtggactgt
tctaaacctcaaggcaataaaggctgtcgtggaggtactacatacaatgcattccagtat
gttttgcaaaatggaggtttggagtctgaggcaacctatccatataaaggaaaagaagga
ctatgcaagtacaatcctaagaatgcatatgctaaaatcacaagatttgttgctctccca
gaagatgaagatgtcctaatggatgctttagcaactaaaggacctgttgctgctggaatt
catgttgtctacagttctttaaggttctacaaaaaaggtatatatcatgagccaaagtgc
aacaatcgtgtgaatcatgcagttctcgtggttggctatggatttgagggaaatgaaaca
gatggcaataactactggctgatcaagaacagctggggtaaacagtggggattgaagggc
tatatgaagatcgccaaagacaggaacaaccactgtggaattgccacatttgcccaatac
cctattgtgtga

DBGET integrated database retrieval system