KEGG   Rattus norvegicus (rat): 408206
Entry
408206            CDS       T01003                                 

Gene name
Ggt6
Definition
(RefSeq) gamma-glutamyl transferase 6
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00430  Taurine and hypotaurine metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    408206 (Ggt6)
   00480 Glutathione metabolism
    408206 (Ggt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    408206 (Ggt6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     408206 (Ggt6)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     408206 (Ggt6)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   408206 (Ggt6)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 408206
NCBI-ProteinID: NP_001002820
RGD: 1303335
Ensembl: ENSRNOG00000015210
UniProt: Q6IE08
Position
10q24
AA seq 498 aa
MDATTGAVLYQKLQLWEPGMESEEEEEEEEIAEPLVLSLRRLQNTPGNKVGGLPGAWTRL
LAGLLLLAVSSSLALRQLQGRNSPKGNLGPVDLPASRHSHHPGVYHHSAVISPAATCSRL
GQELLVAGGNVVDAGVGAALCLAVVHPHATGLGATFWGLFYNSSSGNSTALTAGPAQILA
PGLGLPTALPALHLLHTHFGRLPWSHLLAKPAMLAQKGFEVDAPLASALAAQGTEGLCPL
FCHTNGTPLGLGAQVTNPNLAAVLLREALASSPDLVGNALLNLLVRDLGLELPSVQPKPS
LEPALQLLLPQGVLFTTPGPSAGPELMGLLESTLHSKTPSPASCSSLLQTAETPVSSALA
TVDSHGSMLLLTSSLNSSFGSGHLSPSTGVLLSNLEASSVPSTWACPLILRGNLDDTEDD
MLGLVASGIPRGAKAMACTLFNHLTTPQTQQQVQHQAQQRPTESPGICGKEALLQVVVHA
EHAQVSSIPSGCCPFQGY
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggatgccaccacaggggctgtgctctaccagaagctgcaactctgggagcctggcatg
gagtcagaggaggaggaagaagaggaagaaatagcagaaccactagtcctttccctaagg
agactccaaaatacccccgggaacaaggttggtgggttgccaggagcctggacccgcctg
ctggcaggcctgctgctgctggctgttagcagctccctggctctgaggcagctgcaaggt
aggaacagcccaaaaggaaacttgggccctgtggatcttccagccagcagacactcccac
caccctggtgtgtaccaccacagcgctgtcatcagccctgcagccacatgttcccgactg
ggccaagagctgcttgtcgctgggggcaatgtcgtggatgctggagttggagcagctttg
tgtctggcggtggtgcatcctcatgcaacagggctaggtgccacattctggggtctcttc
tacaatagctcctcaggaaactcaactgccctgacagcaggtccagcccaaatcctggcc
cctggcctgggactgcccacagctctgcctgccctgcatttgcttcatacccacttcggc
cgcctgccctggtcacacctgctggccaagcctgccatgctggctcaaaagggctttgag
gtagatgcacccctggcaagcgcactagcagcccagggtacagaggggctctgtccactg
ttctgccataccaacggaaccccactgggtcttggggctcaagtcaccaaccccaacctg
gcagctgtgttgctccgtgaagccctggcctccagcccagatcttgttgggaatgccttg
ctgaacctgctggtcagagacctggggttagagttgccctctgtgcagcccaagccttcc
ttagagcctgcactgcagcttcttctgcctcagggtgtgctgttcactactcctggcccc
tcagcaggcccagaacttatgggactgttggagtctactcttcactccaagacacccagc
cctgcttcctgctcatcactcctgcagactgctgaaaccccagtgagcagtgccctggcc
actgtggacagccatggctccatgctccttctaacctcctcactcaacagctcctttggc
tctggacatctgtccccaagtactggcgttcttctcagcaacctggaagccagctctgta
cctagtacctgggcctgtccactcattctccgtggcaacctagatgacacagaagacgat
atgttggggctggtggcttcagggatccccagaggggccaaagccatggcttgcaccttg
ttcaatcatctgacaacaccccaaacccaacagcaggtccaacatcaagcccaacaaaga
cccacagaaagccctggcatttgtggcaaagaggctctactgcaggtagtagtccatgca
gaacacgcccaggtctccagcatccctagtggctgctgcccctttcaggggtattaa

DBGET integrated database retrieval system