KEGG   Rattus norvegicus (rat): 414065
Entry
414065            CDS       T01003                                 

Gene name
Nanog
Definition
(RefSeq) Nanog homeobox
  KO
K10164  homeobox protein Nanog
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    414065 (Nanog)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    414065 (Nanog)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    414065 (Nanog)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    414065 (Nanog)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 414065
NCBI-ProteinID: NP_001094251
RGD: 1303178
Ensembl: ENSRNOG00000008368
UniProt: D3ZS29
Position
4q42
AA seq 312 aa
MSVDLSGPHSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGD
LPLQDSPDSSSNPKLKLSGPEADEGPEKKEENKVLTKKQKMRTVFSQAQLCALKDRFQRQ
RYLSLQQMQDLSTILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLTQKGSAPVEYPS
IHCSYSQGYLMNASGNLPVWGSQTWTNPTWNNQTWTNPTWSNQTWTNPTWSNQAWSTQSW
CTQAWNSQTWNAAPLHNFGEDSLQPYVPLQQNFSASDLEANLEATRESQAHFSTPQALEL
FLNYSVNSPGEI
NT seq 939 nt   +upstreamnt  +downstreamnt
atgagcgtggatctttctggtccccacagtctgcctagttgtgaggaagcatcgaactct
ggggattcctcgccgatgcctgccgttcatcttcctgaggaaaattattcttgcttacaa
gtgtctgctactgagatgctctgcacagagactgcctctcctccgccttcctctggggac
ctacctcttcaagatagccctgattcttctagcaatcccaagctaaagctgtctggtccc
gaggctgacgagggccctgagaagaaagaagagaacaaggtcctcaccaagaagcagaag
atgcggactgtgttctctcaggcccagttgtgtgcactcaaggataggtttcagaggcaa
aggtacctcagcctccagcagatgcaagatctctctaccattctgaacctgagctataag
caggtgaagacctggttccaaaaccaaagaatgaagtgcaagaggtggcagaaaaaccaa
tggttgaagactagcaacggcctgactcagaagggctcagcgccggtggagtatcccagc
atccattgcagctattctcagggctatctgatgaacgcgtctggaaaccttccagtatgg
ggcagtcagacctggaccaacccaacttggaacaaccagacctggaccaacccaacctgg
agcaaccagacctggaccaacccaacttggagcaaccaggcctggagcactcagtcctgg
tgtactcaggcctggaacagccagacttggaacgctgctccgctccataacttcggggag
gactccctgcagccttatgtgccgttgcagcaaaacttctccgccagtgatttggaggcg
aatttggaagccactagggaaagccaggcgcattttagtaccccgcaagccttggaattg
ttcctgaactactccgtgaattctccaggcgaaatatga

DBGET integrated database retrieval system