KEGG   Rattus norvegicus (rat): 414826
Entry
414826            CDS       T01003                                 

Gene name
Tesb
Definition
(RefSeq) testis specific basic protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: TFIIA TMEM132D_C
Other DBs
NCBI-GeneID: 414826
NCBI-ProteinID: NP_001106654
RGD: 1597063
Ensembl: ENSRNOG00000039398
Vega: OTTRNOG00000001684
UniProt: Q4V8H4
Position
20p12
AA seq 386 aa
MADLEIVLAVILTVLALAILAILIARWTRRRHEARVSRYTSEQSAGLLDHEDGISHGRHK
RGRGSRCSFSSDSAGTIGPIMQFSAPIPGATGPIKLSQKTFLQTPGPLVQCMDSSESCSP
EGSNAVMPMEMCYPQPSLKSSCYQQCSVKPSCQQGMMPLCPESQTLPLLITQRTGVKKHS
GQMMRHGGSVTFQEDNGDTMKWRRCQCEFCCPKRYESHMAHQRREPIWCEEPAPQQQQQQ
QQQQQQPQQQQQQQQPPPTPPPRRQESQVRFDQRNENCYDAQTICYEEPFLFRRLESLIR
KNQDGIVIKQNEGGLLIKKAEDHPSEHKKKGKPKKSSEPQDTDSDSSAPPSSDQPEAKPE
PQPDEGEEKKQKKEKKKKKKKDKGDG
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcagacctcgaaatagttttggctgtcatcctgactgtattggcccttgctattctg
gctattctgatagcaagatggacgcggcgcagacatgaggcgcgagtctccagatacact
tcagaacagagtgctgggcttctggatcatgaggatggtatttcccatgggaggcacaaa
agaggaagaggatctcgatgctcgttttcatcggatagcgctggaaccattggacctata
atgcagttctccgcacctatccctggagctacgggacctatcaaactgtctcaaaaaacc
ttcctgcaaactcctggccctcttgtgcaatgtatggattctagtgaaagctgcagccct
gagggatccaacgctgtaatgcccatggaaatgtgttatccacagccatcactgaagtct
agctgttatcagcaatgttcagtcaagcctagctgccaacaaggaatgatgcctctctgc
cctgagtcgcagactttacccttattaattacacagagaactggagtgaaaaagcattca
ggccagatgatgaggcacggagggagcgtgaccttccaggaagacaacggagacacaatg
aagtggagaagatgccagtgcgagttctgctgtcctaagagatacgagtcgcacatggcc
caccagcgacgagaacccatatggtgtgaagaaccagcgccgcagcagcagcagcaacag
cagcagcagcagcagcagccacagcagcagcagcagcagcagcagcctcctcctactcct
cctccacgaagacaagaatctcaagtaagatttgaccaaagaaatgaaaactgctatgac
gcccagaccatttgttatgaagaaccattccttttcagaagactggagtccctgataagg
aagaaccaagacgggatagtaataaagcaaaatgaaggcggcctcctgataaagaaggct
gaggaccacccatcagaacacaaaaagaaagggaaacccaagaagtcatcagaaccccaa
gacactgactcggattcaagtgcaccaccaagctcagatcaacctgaagcaaaacccgaa
ccacaaccagacgaaggggaggagaagaaacaaaagaaagaaaagaagaaaaagaagaaa
aaagacaaaggcgatgggtga

DBGET integrated database retrieval system