KEGG   Rattus norvegicus (rat): 432358Help
Entry
432358            CDS       T01003                                 

Gene name
Elavl4, HuD
Definition
(RefSeq) ELAV like RNA binding protein 4
  KO
K13208  ELAV like protein 2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    432358 (Elavl4)
   03041 Spliceosome [BR:rno03041]
    432358 (Elavl4)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     432358 (Elavl4)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    432358 (Elavl4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 BRAP2 RRM_3
Motif
Other DBs
NCBI-GeneID: 432358
NCBI-ProteinID: NP_001071119
RGD: 1560027
Ensembl: ENSRNOG00000023601
UniProt: B0BMT8 A0A140TAF2
Position
5q35
AA seq 385 aa AA seqDB search
MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQ
NMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTK
TIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGV
GFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPG
PLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAI
ASLNGYRLGDRVLQVSFKTNKAHKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaatggcttgaagatgataattagcaccatggagcctcaggtgtcaaatgga
ccgacatccaatacaagcaatggaccctccagcaacaacagaaactgtccttctcccatg
cagacaggcgctgccacagacgacagcaaaaccaacctcatcgtcaactatttaccccag
aatatgacccaagaggaattcaggagtctctttgggagcattggtgaaatcgaatcctgc
aaactcgtgagagacaaaattacaggacagagtttagggtatggatttgttaactatatt
gatccaaaggatgcagagaaagccatcaacactttaaatggactcagactccagaccaaa
accataaaggtgtcgtacgcccgtccgagctcggcctcaatcagggatgctaacctgtac
gttagtggccttcccaagaccatgacccagaaggagctggagcagcttttctctcagtac
ggtcgcatcatcacctcacgcatcctggttgatcaagtcacaggagtctctagaggggtg
ggattcatccgctttgataagaggattgaggcagaagaagccatcaaagggctgaatggc
cagaagcccagcggtgctacagaaccgattactgtgaagtttgccaacaaccccagccag
aagtccagccaggccctgctctcccagctgtaccagtcccccaacaggcgataccctggc
cctctccaccaccaggctcaaagattcaggctggacaatttgcttaatatggcctatggc
gtaaagagactgatgtctggaccagtccccccttctgcttgtccccccaggttctcccca
atcaccattgacgggatgacaagtcttgtgggaatgaacatccctggtcacacagggaca
ggctggtgcatcttcgtctataacctgtcccctgattctgatgagagtgtcctctggcag
ctctttggcccctttggcgcagtgaacaacgtcaaggtcatccgtgacttcaacaccaac
aaatgcaagggattcggctttgtcaccatgaccaactacgatgaggcagccatggccatc
gccagcctcaatggttaccgcctgggagacagagtgttgcaagtttcctttaaaaccaac
aaagcccacaagtcctga

DBGET integrated database retrieval system