KEGG   Rattus norvegicus (rat): 432360Help
Entry
432360            CDS       T01003                                 

Gene name
Sgce
Definition
(RefSeq) sarcoglycan, epsilon
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Sarcoglycan_2
Motif
Other DBs
NCBI-GeneID: 432360
NCBI-ProteinID: NP_001002023
RGD: 1303201
Ensembl: ENSRNOG00000046905
UniProt: Q6YAT4
Position
4q13
AA seq 437 aa AA seqDB search
MLLFWWWELGDPCAWTGKGRGTLKMSPATTGTFLLTVYTLFSKVHSDRNVYPSAGVLFVH
VLEREYFKGEFPPYPKPGEVSNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTA
ENVGKPTIIEITAYNRRTFETARHNLIINIMSAEEFPLPYQAEFFIKNMNVEEMLASEVL
GDFLGAVKNVWQPERLNAINITSALDRGGRVPLPIKDMKEGVYVMVGADVAFSSCLREVE
NPQNQLRCSQEMEPVITCDKKFRTQFYIDWCKISLVDKTKQVSTYQEVVRGEGILPDGGE
YKPPSDSLKSRDYYTDFLVTLAVPSAVALVLFLILAYIMCCRREGVEKRNMQTPDIQLVH
HSSIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPMHTDNYDSTNMPLMQTQPNL
PHQTQIPQQQTTGKWYP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctattattctggtggtgggagctgggagacccttgtgcttggacgggaaagggtcgg
gggacactcaagatgagccccgcgaccactggcacattcttactgacagtgtacactctt
ttctccaaggtgcactctgaccggaacgtctacccatctgcgggtgtcctctttgtccat
gtgctggagagagagtattttaagggggaatttccaccttatccaaagcctggtgaggtt
agtaatgatcccataacatttaacacaaatttaatgggctatccagacagacctggatgg
cttcggtacatccaaagaacaccatacagcgatggagtcctgtatgggtctccaacagcc
gaaaacgtggggaaaccaactatcattgagataactgcctacaacagacgtacctttgag
actgcaaggcataatttgataatcaatataatgtcagcagaagaattcccgttgccatat
caagcagaattcttcatcaaaaatatgaatgtggaagaaatgttggccagtgaggttctt
ggagactttctcggggctgtaaagaatgtgtggcagccggaacgcctcaatgctatcaac
atcacatcggccctagacaggggcggtagggtgccacttcctattaaagacatgaaggag
ggtgtttatgtcatggttggtgccgacgttgcattttcttcttgtttacgagaagttgaa
aatccacagaatcagttaaggtgcagtcaagaaatggaacctgtgataacatgcgataaa
aagttccgaactcagttttacattgactggtgcaagatttcattggttgataaaacaaag
caagtgtccacctatcaggaagtggttcgtggcgagggcattttgcccgatggtggggag
tacaagcccccttcggattctttgaaaagccgagactattacacggatttcctcgttacc
ctggctgtgccctcggcagtagcactagttcttttcctaatactcgcttatatcatgtgc
tgccgacgggaaggagtggaaaagagaaacatgcaaaccccagatatccaacttgtccat
cacagctctattcagaaatctaccaaggagcttcgagacatgtccaaaaacagagagatt
gcatggcccctgtcaacactccccgtgtttcacccagtgactggggagatcatacctccc
atgcacacggacaactacgacagtaccaacatgcccttgatgcagacacagccgaacttg
ccacaccagactcagatcccccaacagcagactacaggtaaatggtatccctga

DBGET integrated database retrieval system