KEGG   Rattus norvegicus (rat): 432392
Entry
432392            CDS       T01003                                 

Gene name
Fut8
Definition
(RefSeq) fucosyltransferase 8
  KO
K00717  glycoprotein 6-alpha-L-fucosyltransferase [EC:2.4.1.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno00533  Glycosaminoglycan biosynthesis - keratan sulfate
rno01100  Metabolic pathways
rno05202  Transcriptional misregulation in cancer
Module
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    432392 (Fut8)
   00513 Various types of N-glycan biosynthesis
    432392 (Fut8)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    432392 (Fut8)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    432392 (Fut8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    432392 (Fut8)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.68  glycoprotein 6-alpha-L-fucosyltransferase
     432392 (Fut8)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  N-Glycan
   432392 (Fut8)
SSDB
Motif
Pfam: SH3_9 SH3_1
Other DBs
NCBI-GeneID: 432392
NCBI-ProteinID: NP_001002289
RGD: 1303096
Ensembl: ENSRNOG00000008451
UniProt: Q6EV76
Position
6q24
AA seq 575 aa
MRAWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGTATGRVRVLEEQLVKAKEQIENYKKQARNGLGKDHELLRRRIE
NGAKELWFFLQSELKKLKHLEGNELQRHADEILLDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKARKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGLSTGHWSGEVNDKNIQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPALLKEAKTK
YSNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAVYPHKPRTDEEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGKTGLYPSYKVREKIETVKYPTYPEAEK
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcgggcatggactggttcctggcgttggattatgctcattctttttgcctgggggacc
ttgttgttttatataggtggtcatttggttcgagataatgaccaccctgatcactctagc
agagaactctccaagattcttgcaaagcttgaacgcttaaaacaacaaaatgaagacttg
aggcgaatggctgagtctctacgaataccagaaggccccattgaccaggggacggctacg
ggaagagtccgtgttttagaagaacagcttgttaaggccaaagaacagattgaaaattac
aagaaacaagccagaaatggtctggggaaggatcatgaactcttaaggaggaggattgaa
aatggagctaaagagctctggttttttctacaaagtgaactgaagaaattaaagcatcta
gaaggaaatgaactccaaagacatgcagatgaaattcttttggatttaggacaccatgaa
aggtctatcatgacggatctatactacctcagtcaaacagatggagcaggggattggcgt
gaaaaagaggccaaagatctgacagagctggtccagcggagaataacttatctccagaat
cccaaggactgcagcaaagccaggaagctggtgtgtaacatcaataagggctgtggctat
ggttgccaactccatcacgtggtctactgtttcatgattgcttatggcacccagcgaaca
ctcatcttggaatctcagaattggcgctatgctactggtggatgggagactgtgtttaga
cctgtaagtgagacatgcacagacagatctggcctctccactggacactggtcaggtgaa
gtgaatgacaaaaatattcaagtggtggagctccccattgtagacagcctccatcctcgg
cctccttacttaccactggctgttccagaagaccttgcagatcgactcgtaagagtccat
ggtgatcctgcagtgtggtgggtgtcccagttcgtcaaatatttgattcgtccacaacct
tggctagaaaaggaaatagaagaagccaccaagaagcttggcttcaaacatccagtcatt
ggagtccatgtcagacgcacagacaaagtgggaacagaggcagccttccatcccatcgaa
gagtacatggtacatgttgaagaacattttcagcttctcgcacgcagaatgcaagtggat
aaaaaaagagtatatctggctaccgatgaccctgctttgttaaaggaggcaaagacaaag
tactccaattatgaatttattagtgataactctatttcttggtcagctggattacacaat
cggtacacagaaaattcacttcggggcgtgatcctggatatacactttctctctcaggct
gacttcctagtgtgtactttttcatcccaggtctgtcgggttgcttatgaaatcatgcaa
accctgcatcctgatgcctctgcaaacttccactctttagatgacatctactattttgga
ggccaaaatgcccacaaccagattgccgtttatcctcacaaacctcgaactgatgaggaa
attccaatggaacctggagatatcattggtgtggctggaaaccattgggatggttattct
aaaggtgtcaacagaaaacttggaaaaacaggcttatatccctcctacaaagtccgagag
aagatagaaacagtcaagtatcccacatatcctgaagctgaaaaatag

DBGET integrated database retrieval system