KEGG   Rattus norvegicus (rat): 436582Help
Entry
436582            CDS       T01003                                 

Gene name
Atp6v0e2, NM9.2
Definition
(RefSeq) ATPase, H+ transporting V0 subunit e2
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    436582 (Atp6v0e2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    436582 (Atp6v0e2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    436582 (Atp6v0e2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    436582 (Atp6v0e2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    436582 (Atp6v0e2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    436582 (Atp6v0e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP_synt_H DrsE_2 Far-17a_AIG1
Motif
Other DBs
NCBI-GeneID: 436582
NCBI-ProteinID: NP_001002253
RGD: 1303238
Ensembl: ENSRNOG00000008218
UniProt: Q5EB76
Position
4q24
AA seq 81 aa AA seqDB search
MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL
NPLFGPQLKNETIWYVRFLWE
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccattcctttgcccttcctgtcatcatcttcaccacattctggggcctcatc
ggcatcgctgggccctggttcgtgcccaaaggacccaaccgtggggtgatcatcaccatg
ctggtagctactgctgtctgctgttacctcttctggctcatcgccatcttggcccagctg
aaccccctatttgggccacagctgaagaatgagaccatctggtacgtgcgcttcctgtgg
gagtga

DBGET integrated database retrieval system