KEGG   Rattus norvegicus (rat): 442921Help
Entry
442921            CDS       T01003                                 

Gene name
Prm3
Definition
(RefSeq) protamine 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NOA36 CENP-B_dimeris DUF4724 RXT2_N Cwf_Cwc_15 FAM176 Pox_Ag35 Nop14 RNA_pol_3_Rpc31 DNA_pol_phi CENP-I PTPRCAP DUF2457 Radial_spoke TLP-20 SDA1 PBP1_TM
Motif
Other DBs
NCBI-GeneID: 442921
NCBI-ProteinID: NP_001002855
RGD: 1587265
Ensembl: ENSRNOG00000002564
UniProt: Q64256
Position
10q11
AA seq 104 aa AA seqDB search
MGSRCAKLSTGHGPAQNTGHSRGHESSMKKLVACVSQDNFSLSSEGEEEEEDEEDEEEED
DDEEDEEEEQIPVKGKLLLLEPEKQDGAEDAVAQPSPEPKQKHS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccgctgtgccaagctcagcaccggccacggcccggcccagaacacgggtcac
agccgtggccacgagtcctccatgaagaaactcgtggcctgtgtgagtcaagacaacttc
tccctgtcatcagagggtgaggaagaggaggaggatgaggaagatgaggaggaggaagat
gatgatgaggaagacgaggaggaggagcagatcccggtgaaaggcaagctgctgctgctg
gagcccgaaaagcaagatggtgctgaggatgctgtggcccagccaagcccggagcccaag
cagaagcactcctga

DBGET integrated database retrieval system