KEGG   Rattus norvegicus (rat): 444985Help
Entry
444985            CDS       T01003                                 

Gene name
Dnmt3b
Definition
(RefSeq) DNA methyltransferase 3 beta
  KO
K17399  DNA (cytosine-5)-methyltransferase 3B [EC:2.1.1.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno05206  MicroRNAs in cancer
Module
rno_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    444985 (Dnmt3b)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    444985 (Dnmt3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    444985 (Dnmt3b)
   03036 Chromosome and associated proteins [BR:rno03036]
    444985 (Dnmt3b)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     444985 (Dnmt3b)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    444985 (Dnmt3b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    444985 (Dnmt3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 444985
NCBI-ProteinID: NP_001003959
RGD: 1303274
Ensembl: ENSRNOG00000010625
UniProt: Q1LZ51
Position
3q41
AA seq 859 aa AA seqDB search
MKGDSRHLNEEEGASGYEDCIIVNGNCSDQSSDTKDAPSPPVLEAICTEPVCTPETRGRR
SSSRLSKREVSSLLNYTQDVVGDGDGEADDGDGSDILMMPKLTRETKDARTPSESPAVRT
RNSNSISSLERQRTSPRITRGRQGRYHVQEYPVEFPATKSRRRRASSSASTPWSSPASIE
LMEDVTPKSSSTPSVDLSQDGPQEGMDATQVDAESRDGDSTEYQDDKEFGIGDLVWGKIK
GFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEIAADKLVALGLFSQHFNLATFNK
LVSYRKAMYHTLEKAMVRAGKTFPSRPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNKQ
PEVHKSKVRRSGSRNLEARRRENKSRRRTTIDFAASEYSTPPKRLKTNSYGGKDRGEDEE
SRERMASDVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQ
SYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAEDAKLQEPWSCYMCLPQRCHGV
LRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLVLKDL
GIKVEKYVASEVCAESIAVGTIKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGSPCNDL
SNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFL
ACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEFSRTAKLKKVQTI
TTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGARQKLLGRSW
SVPVIRHLFAPLKDYFACE
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagacagcagacatcttaatgaagaagagggtgctagtgggtatgaggactgt
atcattgttaatgggaactgtagtgaccagtcctcggacacgaaggatgctccctcaccc
ccagtcttggaggcaatctgcacagagccagtctgtacaccagagaccagaggccgcaga
tcaagctcacggctgtctaagagggaggtctccagccttctgaattacacgcaggacgtg
gtaggagatggagatggtgaagcggatgatggagatggctctgatattctcatgatgcca
aagctcacccgagagaccaaggatgccaggactccctctgaaagcccagccgtccgaacc
cgaaacagcaacagtatctccagcctggagaggcaaagaacctcccccagaatcacgcga
ggccggcagggccgctaccacgttcaggagtaccccgtggagttcccagctaccaagtct
cggaggcggcgagcatcgtcttcagcaagcacgccatggtcatcccctgccagcatcgag
ctcatggaagatgtgacacctaagagcagcagtacgccatcggttgacttgagccaggac
ggccctcaggagggcatggatgccacacaggtggatgcggagagcagggatggtgacagc
actgagtatcaggatgacaaggagtttggaataggtgaccttgtgtggggaaagatcaag
ggcttctcctggtggcctgccatggtggtgtcctggaaagccacctccaagcgccaggcc
atgcccggaatgcgctgggtacagtggtttggcgatggcaagttttctgagatcgctgct
gacaagctggtggctctgggtctgttcagccagcactttaatctggccaccttcaataag
ctggtttcttataggaaggccatgtaccacactctggagaaagccatggtgcgagctggc
aagaccttccccagccgccctggagactcactggaggaccagctgaagcccatgctggag
tgggcccacgggggcttcaagcccactgggatcgagggcctcaaacccaacaacaagcaa
ccagaggttcataagtcgaaggtgcgtcgttcaggcagtaggaacttagaagccaggaga
cgcgagaacaaaagtcgaagacgcacaaccattgactttgccgcttctgagtactccaca
ccccctaagcgcctcaagacaaatagctatggtgggaaggaccgaggggaagatgaggag
agccgagaacggatggcttctgatgtcactaacaacaagggcaatctggaagaccgctgt
ctgtcctgcggtaagaagaaccctgtgtccttccaccccctctttgagggtgggctctgt
cagagttgccgggatcgcttcctggagctcttctacatgtacgatgaggacggctatcag
tcctactgcaccgtgtgctgtgagggccgtgaactgcttctgtgcagtaacacaagctgc
tgcaggtgcttctgtgtggagtgtctggaggtgctggtgggtacaggcacagcggaggat
gccaagctgcaggaaccctggagctgctatatgtgcctcccgcagcgctgccatggggtc
ctgcggcgcaggaaggactggaacatgcgcctgcaagacttcttcactactgatcctgac
ctggaagagtttgagccgcccaagttgtacccagcgattcctgcagccaaaaggaggccc
attagggtcctgtccctgtttgatggaattgcaacagggtacttggtgctcaaggacttg
ggtattaaagtggagaagtacgttgcctctgaagtctgtgcagagtccattgctgtagga
accattaagcatgaaggccaaatcaaatatgtcaatgacgtccggaaaatcaccaagaaa
aatattgaagagtggggcccatttgacttggtgattggcggaagcccatgcaatgatctt
tctaatgtcaatcctgccaggaaaggcctgtatgagggcacaggaaggctcttctttgag
ttttaccacttgctgaattatacacgccccaaggagggcgacaaccgtccattcttctgg
atgttcgagaatgttgtggccatgaaagtgaatgacaagaaagacatctcccgattcctg
gcatgtaacccagtgatgatcgacgccatcaaggtttctgctgctcacagggcccggtac
ttctggggtaatctacctggaatgaacaggcctgtgatagcttcaaagaatgataagctc
gagctacaagactgcttggagttcagtaggacagcaaagttaaagaaagtacagacaata
accaccaagtcgaactccatcagacaggggaaaaaccagcttttccctgtagtcatgaat
ggcaaggatgacgttctgtggtgcactgagctcgaaaggatcttcgggttcccagctcac
tacacagacgtgtccaacatgggccggggcgcccgccagaagctactgggaaggtcctgg
agtgtgccagtcatcagacacctgtttgcccccttgaaggactactttgcatgtgaatag

DBGET integrated database retrieval system