KEGG   Rattus norvegicus (rat): 448830
Entry
448830            CDS       T01003                                 

Gene name
Ly96
Definition
(RefSeq) lymphocyte antigen 96 precursor
  KO
K05400  lymphocyte antigen 96
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05145  Toxoplasmosis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    448830 (Ly96)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    448830 (Ly96)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    448830 (Ly96)
   05133 Pertussis
    448830 (Ly96)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    448830 (Ly96)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    448830 (Ly96)
SSDB
Motif
Pfam: E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 448830
NCBI-ProteinID: NP_001019450
RGD: 1302993
UniProt: Q56DL5
Position
5
AA seq 160 aa
MLPFFLFSTLLSPIFTESERQQWICNSSDAIISYSYCDHMKIPISISSEPCIRLKGTNGF
VHVEFIPRGNLKNLYFNLFININSIELPKRKEIVCHGYDDDYSFCRALKGEAVNTAIPFS
FDGILFPKGHHRCVAEAIAGDTEEKLFCLNFTIIHHHNVN
NT seq 483 nt   +upstreamnt  +downstreamnt
atgttgccattttttctcttttcgacgctgctttctcccatatttactgaatctgagagg
caacagtggatctgcaactcctccgatgcaattatttcctacagttactgtgatcacatg
aaaatccctatttcaattagttctgaaccctgtataagattgaagggaaccaatggattt
gtgcatgttgagttcattccaagaggaaacttaaaaaatttatatttcaacctgttcatc
aatatcaactccatagaattgccgaagcgcaaggaaattgtttgccatggatatgatgat
gattattctttttgcagagctctgaaaggggaggctgtcaacacagcaataccattttcc
ttcgacggaatactatttcctaagggccatcacagatgtgttgcagaagccattgctggg
gatacagaagaaaagctgttttgtttgaatttcaccatcattcaccaccataatgttaat
tag

DBGET integrated database retrieval system