KEGG   Rattus norvegicus (rat): 450223Help
Entry
450223            CDS       T01003                                 

Gene name
Clec4e, Clecsf9, Mincle
Definition
(RefSeq) C-type lectin domain family 4, member E
  KO
K10059  C-type lectin domain family 4 member E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    450223 (Clec4e)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    450223 (Clec4e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    450223 (Clec4e)
   04091 Lectins [BR:rno04091]
    450223 (Clec4e)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   450223 (Clec4e)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    450223 (Clec4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 450223
NCBI-ProteinID: NP_001005897
RGD: 1359298
Ensembl: ENSRNOG00000061394
UniProt: Q67EQ1
Position
4q42
AA seq 215 aa AA seqDB search
MNSTKSPASHHTERECFKNSQVLSWTMAGASILFLSVCFITRCVVTYHSFQIYGQKKLQP
HKTIKELSCYLEASGSVKNCCPLNWKHFQSSCYFFSTTTLSWLSSLKNCSDMGAHLVVIN
TWEEQEFLFRTKPRKKEFYIGLTDQVVEGQWRWVDDTPFTESLSFWDAGEPNNIVFVEDC
ATMRDSSNPRKNWNDVSCFFSMPWICEMPEISPLD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaccaaatcgcctgcatcacaccacacagagagagaatgcttcaaaaactcc
caagtgctttcatggacgatggctggggcctccatcctgtttctcagtgtctgtttcatc
accagatgtgttgtaacatatcacagttttcaaatttatgggcagaagaagttacagcca
cataaaactattaaggagctttcctgctaccttgaagcatcaggttcagtcaagaattgc
tgccctttgaactggaaacattttcagtctagttgctactttttctctacaaccacctta
tcctggctatcaagtctaaagaattgctcagacatgggggctcacctggtggttatcaac
acatgggaagagcaggaattcctttttcgcacaaaacccagaaagaaagagttttacatt
ggactgacagaccaggttgtggagggtcagtggcgatgggtggatgatacacctttcaca
gagtccctgagcttctgggatgctggagagcccaataacatagtttttgtggaggactgt
gccaccatgagggactcttcaaaccccaggaagaactggaatgatgtatcctgtttcttc
agtatgccttggatttgtgagatgccagaaataagtcctttggactag

DBGET integrated database retrieval system