KEGG   Rattus norvegicus (rat): 450225Help
Entry
450225            CDS       T01003                                 

Gene name
Krt10, Ka10
Definition
(RefSeq) keratin 10
  KO
K07604  type I keratin, acidic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    450225 (Krt10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    450225 (Krt10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     450225 (Krt10)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   450225 (Krt10)
  Exosomal proteins of other body fluids (saliva and urine)
   450225 (Krt10)
  Exosomal proteins of colorectal cancer cells
   450225 (Krt10)
  Exosomal proteins of melanoma cells
   450225 (Krt10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 BRE1 Jnk-SapK_ap_N APG6_N Spc7 DUF4407 ATG16 DUF4618 Tox-ODYAM1
Motif
Other DBs
NCBI-GeneID: 450225
NCBI-ProteinID: NP_001008804
RGD: 1359092
Ensembl: ENSRNOG00000030170
Vega: OTTRNOG00000001546
UniProt: Q6IFW6
Position
10q31
AA seq 526 aa AA seqDB search
MSVRFSSNSRQYSSARSGGGGGGGGGGSSIRVSSTKSSLGGGYSSGGFSGGSFSRGSSSG
GCFGGSSGGYGGFGGGSFGGGYGGGSFGGGYGGGSFGGGYGGGSFGGGYGGGSFGGGSFG
GGSFGGGSFGGGLGGDGGGLLSGNEKVTMQNLNDRLASYMNKVRDLEESNYELEGKIKEW
YEKHGNSSQREPRDYSKYYKTIEDLKGQIVNLTTDNANVLLQIDNARLAADDFRLKYENE
VALRQSVEADINGLRRVLDELTLSKADLEMQIESLTEELAYLKKNHEEEMKDLQNVSTGD
VNVEMNAAPGVDLTQLLNNMRNQYEQLAEKNRKDAEAWFNEKSKELTTEIDSNIEQMSSH
KSEITELRRTVQGLEIELQSQLALKQSLEASLAETEGRYCVQLSQIQSQISALEEQLQQI
RAETECQNAEYQQLLDIKTRLENEIQTYRSLLEGEGGYVGNLQITLNCFPSEFHLAKLTQ
TQGKTRGWKGSNTNKTRVIKTIIEEVTPEGRVLSSMIESETKKHFY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgattcagctccaacagcaggcagtactcctccgcccgcagtggaggagga
ggaggaggtggtggtggtggatcatccatcagagtttccagcaccaaaagctcccttggt
ggagggtacagctcaggggggttcagcggtggctcttttagccgtgggagctctagcgga
ggttgctttgggggctcatcaggtggctatggaggctttggagggggcagcttcgggggt
ggctatggaggaggcagctttggtggaggctacggaggaggcagctttggtggaggctat
ggaggaggcagcttcggtggaggatatggaggaggcagcttcggtggaggcagcttcggt
ggaggaagcttcggtggaggaagcttcggcggtgggcttggaggagatggtggtggcctt
ctctctggaaatgaaaaggtgaccatgcagaacctgaatgaccgcctggcctcctacatg
aacaaggtccgggatctggaagagtcaaactatgagctggagggtaaaatcaaggagtgg
tacgagaagcacggcaactccagccagcgagagccccgggactacagcaaatactacaaa
accatcgaagaccttaaagggcagatcgtcaacctgacaactgacaatgccaatgtcctg
ctgcagattgacaatgccagactggcagctgatgacttcaggctgaagtatgagaatgaa
gtagccctgcgccagagtgtggaggccgacattaatggcctgcgcagggtgctggacgaa
ctgaccctcagcaaggctgacctggagatgcagatcgaaagtttgactgaagagctggct
tacctgaagaagaaccacgaagaggaaatgaaagaccttcaaaatgtatccactggtgat
gtgaacgtggaaatgaacgctgccccaggggtggacctgactcagctgctcaacaacatg
agaaaccaatacgaacaacttgcagaaaagaatcgcaaggacgcagaagcctggttcaat
gagaagagcaaggaactcaccacagaaatcgacagcaacattgaacaaatgtccagccat
aagagtgaaatcactgaattgagacgcactgttcagggtctggagatcgaactacagtcc
cagctggccctgaaacaatcgctggaagcctccttggcagaaacagaaggacgctactgc
gtgcagctctcccagattcaaagccagatctccgccctggaggaacaactgcaacagatt
cgggctgaaaccgagtgccagaacgccgagtaccaacaactcctagacattaagacccgc
ctggagaacgagatccaaacctaccgcagcctgctagaaggagaaggagggtatgttgga
aacctgcaaataaccctcaattgctttccttcagaattccacttagcaaagcttacccaa
acccaaggaaaaaccagaggctggaaggggagcaatactaataaaaccagagtgatcaag
acgattattgaggaggtgacacctgagggtagagtcctttcgtctatgattgaatcagaa
accaagaaacacttctactaa

DBGET integrated database retrieval system