KEGG   Rattus norvegicus (rat): 450228
Entry
450228            CDS       T01003                                 

Gene name
Krt31, Ka25
Definition
(RefSeq) keratin 31
  KO
K07604  type I keratin, acidic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    450228 (Krt31)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    450228 (Krt31)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    450228 (Krt31)
   04147 Exosome [BR:rno04147]
    450228 (Krt31)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     450228 (Krt31)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   450228 (Krt31)
  Exosomal proteins of other body fluids (saliva and urine)
   450228 (Krt31)
  Exosomal proteins of colorectal cancer cells
   450228 (Krt31)
  Exosomal proteins of melanoma cells
   450228 (Krt31)
SSDB
Motif
Pfam: Filament IMD DUF4677 TPR_MLP1_2 ERM
Other DBs
NCBI-GeneID: 450228
NCBI-ProteinID: NP_001008817
RGD: 1359411
Ensembl: ENSRNOG00000030344
Vega: OTTRNOG00000000229
UniProt: Q6IFV8
Position
10q31
AA seq 414 aa
MPYNCCLPALSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNEKETM
QFLNDRLASYLEKVRQLERENAELESRIQERSQQQDPLVCPAYQAYFRTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYETELSLRQLVESDINGLRRILDELTLCKSDLEAQV
ESLKEELLCLKRNHEEEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
REVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHRNSLDDTLTE
SEARYCSALSQGQCLITNVESQLGEIRADLERQNQEYQVLLDIRARLECEINTYRGLLES
EDCKLPCNPCATSNACGKPIGPCVSNPCAPCPPPAPCTPCVPRSRCGPCNSFVR
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccatacaactgctgcctgcccgccctgagctgccgaaccagctgctcctccaggccc
tgcgtgccccccagctgccatggctgcaccctgcccggggcctgcaacatccccgccaat
gtgggcaactgcaattggttctgtgagggctccttcaatggcaatgagaaggagaccatg
cagttcctgaatgaccgcctggcctcctacctggagaaggtgaggcaactggagagagag
aatgcagagctggaaagcaggatccaggagaggagccagcagcaggaccccctggtgtgt
cccgcctaccaggcctacttcaggaccattgaggagctgcagcagaagatcctgtgcagc
aaatctgagaacgccaggctggtggtgcagattgacaacgccaagctggctgcagacgac
ttcaggaccaagtatgagacagagctcagtctgaggcagctggtggagtcagacatcaat
ggcctgcgcagaatcctggacgagctgaccctctgcaagtctgacctggaggcacaggtg
gagtccctgaaggaggagctgctgtgtctcaagaggaaccacgaggaggaagtcaacacc
ctgcgctgccagcttggagaccgcctcaacgtcgaggtggacgctgctcccactgtggac
ctgaaccgggtgctcaatgagaccaggtgtcagtacgaggccctggtggaaaccaaccgc
cgggaagtggaggaatggttcaccacacagactgaggagctgaacaagcaggtggtgtcc
agctcagagcagctgcagtcctgccaggccgagatcatcgagctgagacgcacagtcaat
gccctggagatcgagctgcaggcccagcacagaaactctctggatgacaccctgacagag
agtgaggctcgctactgctccgccctatcccaggggcagtgcctgatcaccaacgtggag
tcccagcttggtgagatccgggctgacctggagcgtcagaaccaggagtaccaggtgctg
ctggacatccgggcccggctggagtgtgagatcaacacgtacaggggcctgctggagagc
gaggactgcaagctaccttgcaacccctgtgccacaagcaacgcgtgcggcaagcccatt
gggccctgcgtctccaatccctgcgccccctgcccaccccctgccccttgcacaccttgt
gtcccacgttcccgctgtgggccatgcaatagctttgtacgctag

DBGET integrated database retrieval system