KEGG   Rattus norvegicus (rat): 474146Help
Entry
474146            CDS       T01003                                 

Gene name
Hcst, Dap10
Definition
(RefSeq) hematopoietic cell signal transducer
  KO
K07988  hematopoietic cell signal transducer
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    474146 (Hcst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAP10 MAP17
Motif
Other DBs
NCBI-GeneID: 474146
NCBI-ProteinID: NP_001005900
RGD: 1359238
Ensembl: ENSRNOG00000020849
UniProt: Q6X9T8
Position
1q21
AA seq 79 aa AA seqDB search
MAPPGHLLFLFLLPVAASQTNEGSCSGCGPLSLPLLAGLVAADAVMSLLIVGVVFVCMRL
HSRPAQEDGRVYINMPGRG
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcccctccaggtcacctcctgttcctgttcctgctcccagtggccgcaagtcagaca
aacgaaggttcctgctccggatgtgggcctctgtccctgccactcctggcaggcctggtg
gctgcagatgcggtcatgtcacttctaatagtgggggtggtgtttgtatgtatgcgccta
cacagcaggcctgcccaagaagatggtcgagtctacatcaacatgcctgggagaggctga

DBGET integrated database retrieval system