KEGG   Rattus norvegicus (rat): 492821Help
Entry
492821            CDS       T01003                                 

Gene name
Pmaip1, Noxa
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    492821 (Pmaip1)
   04215 Apoptosis - multiple species
    492821 (Pmaip1)
   04115 p53 signaling pathway
    492821 (Pmaip1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    492821 (Pmaip1)
   05203 Viral carcinogenesis
    492821 (Pmaip1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    492821 (Pmaip1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    492821 (Pmaip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMAIP1
Motif
Other DBs
NCBI-GeneID: 492821
NCBI-ProteinID: NP_001008386
RGD: 1359266
Ensembl: ENSRNOG00000018770
UniProt: Q5U777
Position
18q12.1
AA seq 105 aa AA seqDB search
MPGRKARRNAPLNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITAVLAQMPGKKSRKSTM
RRSPSPTRVPADLKDECDQLRRIGDKVNLRQKLLNFISKLFNLIT
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggagaaaggcgcgtcggaacgcgccattgaacccaacgcgggcagagttaccg
cctgaattcgcagctcagctcaggaagattggagataaagtgtactgcacgtggagtgca
ccggacataactgcggttctggcgcagatgcctggcaagaagtcgcgaaagagcacgatg
agaagaagcccaagcccaacccgggtgccagcagacctgaaggacgagtgtgatcaactc
cggagaattggagacaaagtgaatttacggcagaaacttctgaattttatttccaagctc
ttcaatttaataacctga

DBGET integrated database retrieval system