KEGG   Rattus norvegicus (rat): 494021Help
Entry
494021            CDS       T01003                                 

Gene name
Lmcd1, LIMD1
Definition
(RefSeq) LIM and cysteine-rich domains 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PET LIM
Motif
Other DBs
NCBI-GeneID: 494021
NCBI-ProteinID: NP_001008562
RGD: 1308963
Ensembl: ENSRNOG00000005690
UniProt: Q6AYF2
Position
4q41
AA seq 365 aa AA seqDB search
MAKVAKDLNPRVQKMSLGQQQSARGVACLRCKGMCSGFEPHSWRKICKSCKCSQEEHCLS
SDLEDDRKIGRLLMDSKYATLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW
APPGVTQKLGLQYMELIPKEKQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELK
AMEEFVKQYKSEALGVGEVALPGQGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVE
YVCELCKGVAPADSPVVYADRAGYSKQWHPTCFLCIKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCDEIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIITKGQLLCPTCS
KSKRS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtagccaaggacctcaaccctcgagtgcaaaagatgtccctgggccagcag
cagtccgcaagaggagtggcttgtctgcggtgcaaggggatgtgctccggcttcgagccg
cattcatggaggaaaatatgcaagtcttgtaaatgcagccaggaggagcactgcctaagc
tctgacctggaggatgatcggaaaattgggcgcctgctgatggactccaagtatgccact
cttactgccagggtgaaaggtggagacggcattcgcatctataagagaaaccgcatgatc
atgaccaaccccattgccactggcaaagaccccacctttgacactatcacctatgagtgg
gctcccccaggagtcacccagaaactgggcttgcagtacatggagctcatccccaaggag
aagcagcctgtgacaggtactgagggtgccctctaccgccgacgccagctcatgcaccag
ctcccaatctatgatcaggacccctctcgatgccgcggacttgtggagaatgagctgaaa
gctatggaagagttcgtcaagcagtacaagagcgaggcccttggggtgggcgaggtggcc
ctcccagggcagggaggcttgcccaaggaagaaaacaagacacaggaaaagccagagggc
acagagaccactgccccaaccaccaatggcagcctgggtgatccatccaaggaagtggaa
tatgtctgtgagctctgcaagggagtagcccctgctgacagccctgtggtctacgctgac
agggctggatacagcaagcagtggcaccccacatgctttctgtgtatcaagtgctcagag
ccactggtggacctcatctacttctggaaggatggtgcaccctggtgtgggcgccactac
tgcgagagcttgcggccccggtgctcaggctgtgacgagatcatcttctcagaagactac
cagcgtgtggaagacttagcctggcatcggaaacacttcatttgtgagggctgtgagcag
ctgctgagcggccgtgcatacatcatcaccaagggtcagctcctgtgccccacttgcagc
aagtccaaacgctcctga

DBGET integrated database retrieval system