KEGG   Rattus norvegicus (rat): 494206Help
Entry
494206            CDS       T01003                                 

Gene name
Ly49si1
Definition
(RefSeq) immunoreceptor Ly49si1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ly49 Lectin_C
Motif
Other DBs
NCBI-GeneID: 494206
NCBI-ProteinID: NP_001009497
RGD: 1359487
Ensembl: ENSRNOG00000061895
UniProt: Q5MPP4
Position
4q42
AA seq 268 aa AA seqDB search
MSEQEVSYSNVRFKKCSGLQNQVRPEETQRARAAGHRERSVPWQLIVVALVILCSLRLVA
VAIFVTNIFQYTHEKYELPEETPSLINNCSTMQSDIDLKEEMLRNMSINCSQGNDFLQSL
NRVQTRWYRETKTVLPSSQHTGKNVEIYWFCYGIKCYYFILDTKAWNGCKQTCQDSSLSL
LKIDDEDELKFLRFQVLSDQYWIGLSYNKREKKWSWIDNGQSEFSLNLKKYNVKDGECMF
LSKMRLENAKCMNPFPCICQKRLDKFPH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaggaggtgtcttactcaaatgtgagatttaaaaaatgttcaggtttgcag
aaccaagtgagacctgaggagactcaaagggccagagcagctggccacagagagaggtca
gtcccttggcagctcattgtggtagctcttgtaatcctctgttcccttcggctggtagct
gttgcaattttcgtgacaaacatttttcagtatactcatgaaaaatatgaactgccagag
gaaactccaagccttatcaataactgcagcaccatgcaaagtgacatcgatttaaaggaa
gaaatgctaagaaatatgtctataaactgtagtcaaggcaatgatttcctgcaatctcta
aacagagtacagacaagatggtaccgtgaaactaagactgttttaccttcctctcagcac
acaggcaaaaatgttgaaatatactggttctgttatggtataaaatgttattatttcatc
ctggacacaaaggcatggaatggatgtaaacagacctgccaggattccagtttatccctt
ctgaagatagatgatgaggacgaactgaagttccttcggttccaggttctttcagaccag
tactggattggattgtcatataataaaagagaaaagaaatggtcatggattgataatggc
caatctgaattttccttgaacctaaagaaatacaatgtaaaggatggagaatgtatgttc
ttatctaaaatgagactagaaaatgctaagtgcatgaaccccttcccatgtatttgtcag
aagagactggataaattccctcattga

DBGET integrated database retrieval system