KEGG   Rattus norvegicus (rat): 494207Help
Entry
494207            CDS       T01003                                 

Gene name
Ly49si2
Definition
(RefSeq) immunoreceptor Ly49si2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ly49 Lectin_C
Motif
Other DBs
NCBI-GeneID: 494207
NCBI-ProteinID: NP_001009498
RGD: 1359240
Ensembl: ENSRNOG00000055455
UniProt: Q5MPP6
Position
4q42
AA seq 267 aa AA seqDB search
MSEQEVSYSNVRFQKCSDLQNQVRPEETQRARAAGHRERSVPWQLIVVALVILCSLRLVA
VVMFVTNIFQYTHEKHELHETLSHKYNCTSMPNDIDLKEEMLRNMFINCSRGNDLLLSLK
REQTRWYRETKTVIPSFQHTGKNVEIYWFCYGIKCYYFILDKKTWIRCQQACQKSRLSLL
KIDDEDELKFLQLQVLSDQYWIGLSYNKAKEEWSWIDNGQSEFSLNLKKYNEKYGGCMFL
SQTRLENAMCMNRYPCICQKRLEKFPD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggaggtgtcttactcaaatgtgagatttcaaaaatgttcagatttgcag
aaccaagtgagacctgaggagacccaaagggccagagcagctggccacagagagaggtca
gtcccctggcagctcattgtggtagctcttgtaatcctctgttcccttcggctggtagct
gttgtaatgttcgtgacaaacatttttcagtatactcatgaaaaacatgaactgcatgag
actctaagccacaagtataattgcacatccatgccgaatgacattgacttaaaggaagaa
atgctaagaaatatgtttataaattgtagtcgaggcaatgatcttctgctatcactaaag
agagaacagacaagatggtaccgtgaaactaagactgttataccttcctttcagcacaca
ggcaaaaatgttgaaatatactggttctgctatggtataaaatgttattatttcatcctg
gacaaaaaaacctggatcagatgtcaacaagcctgccagaaatccagattatcccttctg
aagatagatgatgaggatgagctgaagttccttcagctccaggttctttcagaccagtac
tggattggattgtcatacaataaagcaaaagaggaatggtcatggattgataatggccaa
tctgaattttccttgaacctaaaaaaatacaatgaaaagtatggaggatgtatgttctta
tctcaaacaagactagaaaatgctatgtgcatgaaccgttacccatgtatttgtcagaag
agacttgagaaattccctgattga

DBGET integrated database retrieval system