KEGG   Rattus norvegicus (rat): 494219
Entry
494219            CDS       T01003                                 

Gene name
Eogt, Aer61
Definition
(RefSeq) EGF domain specific O-linked N-acetylglucosamine transferase
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    494219 (Eogt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    494219 (Eogt)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     494219 (Eogt)
Glycosyltransferases [BR:rno01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   494219 (Eogt)
SSDB
Motif
Pfam: DUF563
Other DBs
NCBI-GeneID: 494219
NCBI-ProteinID: NP_001009502
RGD: 1359357
Ensembl: ENSRNOG00000024533
UniProt: Q5NDL0
Position
4q34
AA seq 527 aa
MLMLLVFGVLLHEVPLSGQDEAHPEADRVPGEALYDYSSLRLPEEHIPFFLHSNRHVASV
CREDSHCPYKKHLESLNSCWGYEKSCTPESRFGSPICSYVDLGWTDTLESAQDMFWKQAD
FGYARERLEEIRMFCRPESASDSSLLCSRYLQYCRATGLYLDLRNIKRNHDRFKEDFLQG
GDIGGYCKLDRHALVSEGQRKSPLQSWFAELQGYTQLNFRPIEDAKCDIVVEKPTYFMKL
DAGINMYHHFCDFLNLYLTQHINNSFSTDVYIVMWDTSSYGYGDLFSDTWKAFTDYDVIH
LKTYDSKKVCFKEAVFSLLPRMRYGLFYNTPLISGCQNTGLFRAFSQHVLHRLNISQEGP
KDGKLRVTILARSTEYRKILNQNELVNALKTVSTFEVRVVDYKYRELGFLDQLRITHNTD
IFIGMHGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGIYYITWQKPSKVFPQDKG
HHPTLGEHPKFTNYSFDVEEFMYLVLQAAEHVLQHPQWPLKKNHDEL
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgttaatgctgcttgtctttggagtactgcttcatgaagtccccctgagtggccaggac
gaggctcatcctgaggctgacagagtgcccggcgaagccctctatgactactccagcctc
cgcctcccagaggagcacattcccttcttcctgcacagtaacaggcatgttgcctctgtg
tgcagggaggattcccactgtccgtataagaaacacttagagagtctaaattcctgctgg
gggtatgagaagtcctgcacaccagagtctagatttggctcccccatttgcagctatgtg
gacttgggatggaccgacaccctggagtcagcccaggacatgttctggaaacaagctgac
ttcggatatgctcgggagcggctggaggagatacgaatgttctgccggccagagagtgcg
agcgactcaagtctgctttgctctcgttaccttcagtattgtagagctactggtctatac
ctggacttaagaaacatcaagagaaaccatgacagattcaaggaagattttcttcagggt
ggtgatattggaggatactgtaaacttgaccgtcatgcactggtgtctgaaggtcagcgc
aaaagccctctgcagtcttggtttgctgagctacaaggctacactcagctcaatttcagg
cctatagaagatgctaaatgtgacatcgttgttgaaaaaccaacatattttatgaaatta
gatgcaggtattaacatgtaccaccacttttgtgacttcctgaatctctacctcactcag
cacataaacaattctttcagtacagacgtgtacattgtcatgtgggacaccagctcttat
ggatacggtgacctcttctctgatacctggaaagcatttactgactatgacgtcatacat
ttgaaaacctacgattccaaaaaggtgtgttttaaagaagctgtgttttcgttgctgccc
cgcatgcggtacgggctgttctataacacgcctctgatctctggctgtcagaacactggg
ttattcagggccttctcccagcacgtgctgcacaggctgaacatctctcaagagggaccc
aaggatgggaaacttcgagttaccattcttgcacgcagcacagaataccggaaaatcctg
aaccaaaatgagctggtaaatgccctgaaaacagtatccacatttgaagtccgggtggtt
gattacaagtacagagaactcgggtttttagatcagctaaggatcacgcacaacacggac
atatttatcggcatgcacggagctggtcttacccacttacttttccttccagactgggct
gctgtattcgagctgtacaactgtgaggatgagcgctgttacttagacctggccaggctc
agaggcatctactacatcacctggcagaagcccagcaaagtgtttcctcaagataagggg
caccatccaactctgggggagcacccgaagtttaccaactactctttcgacgtagaggaa
ttcatgtaccttgtcctgcaggctgcagaacatgtactgcagcacccgcagtggccgttg
aagaagaaccacgatgaactatag

DBGET integrated database retrieval system