KEGG   Rattus norvegicus (rat): 494253Help
Entry
494253            CDS       T01003                                 

Gene name
Vom1r2, V1re26
Definition
(RefSeq) vomeronasal 1 receptor 2
  KO
K04614  vomeronasal 1 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    494253 (Vom1r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V1R TAS2R
Motif
Other DBs
NCBI-GeneID: 494253
NCBI-ProteinID: NP_001008903
RGD: 1359101
Ensembl: ENSRNOG00000034119
Position
1q21
AA seq 302 aa AA seqDB search
MYLKDLIIGIVFLLQSTIGILGNFSLLSCNLINYYIEHKMKTSNLILSHLFTANILILVS
SGLLHTEQTFVIKVFINDFVCKFLLYIQRLGRNVSISTTCFLSVFQAITISPRNSFWMNL
KAKAPHHIGLFTSLCWILYMVLNMIFPVYMYNKENRKNLTHKNYLKYCSTVVHDDFVDRL
YTTIIVLPEILFSFIIIWSSSSMVIILYMHKQSVQHIHSTSVCSRTSPESRATQRILTLM
STFISFYALSSILQGCIALVYNPGWWLINITAVISMCFPTFGPFVMNHDSIKLSYARNSQ
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtacctcaaggatttgataataggaatagtgttcttacttcagagtacaattgggatt
ctgggaaatttctctcttctttcctgcaacctgatcaattactatattgaacataaaatg
aagacttcaaatttgattctttcacatctatttacagccaacattttgatccttgtgtct
tcaggactgctacatacagaacaaacttttgtgataaaagtatttatcaatgattttgtc
tgcaaattccttttgtatattcaaaggctgggcagaaacgtgtccattagtaccacctgc
tttttgagtgtcttccaggcaatcaccatcagtcctaggaactctttttggatgaacctt
aaagccaaagctccacatcatattggtctcttcacttctctttgctggattctctacatg
gtattaaatatgatttttcctgtgtatatgtataacaaagagaacagaaagaatctgaca
cataaaaattacttgaaatattgttccactgtagttcatgatgactttgtagaccgatta
tatactacaattattgttcttcctgaaattttgttttctttcattatcatctggtcgagc
agctccatggttatcattctctatatgcacaagcaaagtgttcaacatatccatagcacc
tctgtttgctccagaacatctcctgaatccagagctacccagaggatactgacccttatg
tccacatttataagtttttatgccctctcttcaatcttacaaggctgcattgctcttgta
tataatcctggttggtggctgataaacatcacagcagtcatttcaatgtgttttcctact
tttggaccttttgtgatgaatcatgactcaattaagctttcctatgctagaaattctcaa
cgtacatag

DBGET integrated database retrieval system