KEGG   Rattus norvegicus (rat): 494255Help
Entry
494255            CDS       T01003                                 

Gene name
Vom1r68, V1rc1
Definition
(RefSeq) vomeronasal 1 receptor 68
  KO
K04614  vomeronasal 1 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    494255 (Vom1r68)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V1R 7tm_1
Motif
Other DBs
NCBI-GeneID: 494255
NCBI-ProteinID: NP_001008906
RGD: 1549721
Ensembl: ENSRNOG00000051513
Position
4q24
AA seq 303 aa AA seqDB search
MSSFKNVFYFQAGLGILANMFLPFFYTFIILGHKPRPTDLISCQLTFIHIIMVLIGGDIL
FTDLFELLNIENDFKCKTIFYTSRVMRGLSICTTCLLSVFQAVTISPNTSFLAKFKQKLK
KYMVYVFLCIWSFNLSFSTNRIFYVGGFINVSETNQMQVTKSCSLLPMDTIIRALIFTIS
TSRDVFLVGVMLTTSVYMVITMFRHQRQCKYLYSISSLRESPEKRATKTILLLVSFFVIM
YWVDFIISFTSDMLWMYDPVILTFQKFLMYAYPTITPLVQISSDNRIIIMLKNMQSKRYR
SFV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcattcaagaatgtattttatttccaagctggacttggaatcctagcaaatatg
tttcttccttttttctataccttcataattctaggtcacaaacctaggcctacagatctg
atctcttgtcaactgactttcatccacataataatggttcttattggaggggatattttg
tttacagacttatttgagttactaaacattgagaatgacttcaaatgtaagacaattttt
tatactagcagagtgatgagaggcctctctatctgtaccacctgcctcctgagtgtgttc
caggctgtcacgatcagtcccaatacctcttttttggctaaatttaaacaaaaactaaaa
aagtatatggtctatgttttcttgtgtatttggtctttcaatttgtccttcagtaccaac
cggatcttctatgttggtggttttatcaatgtgagtgagaccaaccagatgcaggtcact
aaatcctgctcacttttacccatggacaccattatcagggcattgatttttacaatttca
acctccagagatgtgtttcttgtaggagtcatgctaaccacaagtgtgtacatggtgatt
accatgttcaggcatcaaaggcaatgcaagtatctttatagcatcagcagtctgagagag
tcccctgagaaaagggccaccaagaccatcttgctactggtgtctttctttgtcatcatg
tactgggtggacttcatcatctcattcacctcagacatgttatggatgtacgacccagtc
atcctgacttttcagaagtttctgatgtatgcctatcctacaattacccctttggtacaa
attagttctgataacagaataataattatgctaaaaaatatgcagtcaaagcgttaccgg
agttttgtttaa

DBGET integrated database retrieval system