KEGG   Rattus norvegicus (rat): 494268Help
Entry
494268            CDS       T01003                                 

Gene name
Vom1r35, V1rd7
Definition
(RefSeq) vomeronasal 1 receptor 35
  KO
K04614  vomeronasal 1 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    494268 (Vom1r35)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    494268 (Vom1r35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V1R TAS2R
Motif
Other DBs
NCBI-GeneID: 494268
NCBI-ProteinID: NP_001008919
RGD: 1359552
Ensembl: ENSRNOG00000033755
Position
1q12
AA seq 304 aa AA seqDB search
MLSQNKSVKTTEEVALQILLLCQVGVGTVVNVFLFVHNLSPILNGSQQRPIQVILANLAV
GNALILFFAFPNNMTLFVPREPPTDLKCKLGYFIWLVVRSTNMCSTCSLSTYQFVTLAPG
SWARVILSRRDTKFVSYTCYSCWFFSVLNNAHIPMKISGPQKMHNDTNSKSKWACSTTGF
SVGMSILLFVHDAVFISIIVWTSVSMVILLNRHHHRLQHIHSSNQDHRGYAETKAAYTIL
MLVVTFVTFYLLDCICTFLHISFVDSRLWLRRVREILAVSFPTFSPLLLILRDSKDPCSL
LFNC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctcagaataaatctgtgaaaaccacagaggaagtagctcttcagatcctcttg
ctttgccaggttggggttgggactgtggttaacgtttttctatttgtccataatttatct
cctatcttgaatggctctcaacagaggcccatacaagttattctagccaacttagctgtg
ggcaatgccttgattctattctttgcatttccaaacaatatgacactttttgtgccaagg
gagcctccaactgacctaaaatgtaaacttgggtacttcatttggcttgtggttcgaagc
acaaacatgtgctccacctgctccctgagcacttatcagtttgtcactcttgctcctggt
tcctgggctagggtgatactcagtagaagagacaccaaatttgtgagttatacttgttat
agttgttggtttttcagtgtattaaataatgctcacattccaatgaaaatcagtggtcca
cagaaaatgcataatgataccaattctaaaagcaagtgggcttgctccaccactggtttc
agtgtaggcatgagcatcttgttgtttgtccatgatgcagtgttcatcagcatcattgtc
tggaccagtgtctccatggtaattctcctgaacagacaccaccatagactgcagcacatt
cactcctccaatcaggaccacagaggttatgctgagaccaaagcagcctacaccatcctg
atgctggtggtcacatttgtgaccttttatcttctagactgtatttgtaccttccttcac
atttcttttgtggactctcggctctggttaaggcgtgtcagagaaattttggctgtaagt
ttccccaccttttctccattactgttaatcttaagggattctaaggatccttgttctcta
ttattcaactgctga

DBGET integrated database retrieval system