KEGG   Rattus norvegicus (rat): 494282Help
Entry
494282            CDS       T01003                                 

Gene name
Vom1r61, V1rj3
Definition
(RefSeq) vomeronasal 1 receptor 61
  KO
K04614  vomeronasal 1 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    494282 (Vom1r61)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    494282 (Vom1r61)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V1R
Motif
Other DBs
NCBI-GeneID: 494282
NCBI-ProteinID: NP_001008935
RGD: 1359582
Ensembl: ENSRNOG00000014181
Position
1q21
AA seq 317 aa AA seqDB search
MMFPSNTLLGVFFISELCVGVIGNSLLFMVYVHNFLVKAYISRPINPIFMHLVIVNMLTI
IFALIPYITSSFGVPNFLDDAGCKAIVYAYRVTRAMSISTTSILSIFQAITITPSNSKWA
RLKPKLSIWTFDSFLFSWFINLVIYVLLIETVIAKINYTEIEYAYSHVYCGNVPLEYPNV
ELFLSVIIIRDLFFMAILVWTSLYMVTLLCRHQKRAKHLRNPNLSSQSSPEHKATHTILL
IVNCFVFFYLLNNFSTIYDKFCTNERMPSWGAIIAIVASLYPTLCPFLLLNTHKIISQYI
SSLPILRITCYQRAVGD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttccaagcaacaccctcttgggggttttctttatatctgagctctgtgtgggt
gtcatagggaactcattgctcttcatggtgtatgtgcacaacttcttggttaaagcttac
attagtagaccaatcaatcccattttcatgcacctggtgatagtcaatatgttgacaatc
atatttgctctgataccatatatcacttcatcctttggagtacccaattttctggatgat
gctggctgtaaggccattgtgtatgcctacagagtcacccgggctatgtccatctctacc
acttctattctaagcatattccaagccatcaccatcactcccagtaattctaagtgggca
aggcttaagcctaaactctctatatggacatttgactccttcctgttttcctggttcatc
aacctggtcatatatgtgctcctcattgagactgtgatagcgaaaatcaattacactgag
attgaatatgcatattctcatgtttactgtggaaatgttccacttgagtatcccaatgtg
gaattattcctgagtgttatcataataagagatttgttctttatggccatcctggtatgg
accagcctctacatggtgaccctcctctgcaggcaccaaaaaagagccaaacatctccgc
aacccaaacctctcctcccaatcttctcctgaacacaaagccactcacacaatcctgttg
attgtaaactgttttgtgttcttttatttgttgaacaacttttccaccatttatgacaag
ttttgtactaatgaaagaatgccaagttggggggcaattatcgccattgtggcatcattg
taccccactctctgcccatttttactgttgaacactcataaaattatttcacagtatatt
tcttccctaccaatactgagaattacttgttatcaaagagcagttggtgactga

DBGET integrated database retrieval system