KEGG   Rattus norvegicus (rat): 494338Help
Entry
494338            CDS       T01003                                 

Gene name
Trim25, Efp, Znf147
Definition
(RefSeq) tripartite motif-containing 25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    494338 (Trim25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    494338 (Trim25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    494338 (Trim25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    494338 (Trim25)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     494338 (Trim25)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    494338 (Trim25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY PRY zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-C3HC4_3 Prok-RING_4 C5HCH zf-UBP_var U-box zinc_ribbon_4
Motif
Other DBs
NCBI-GeneID: 494338
NCBI-ProteinID: NP_001009536
RGD: 1594396
Ensembl: ENSRNOG00000002341
UniProt: Q6P7B3
Position
10q26
AA seq 643 aa AA seqDB search
MAELFPLAEELSCSICLEPFKEPVTTPCGHNFCRSCLNETWVVQGPPYRCPQCRTVYQVR
PQLHKNTVLCAVVEQFLQAEQARTPVDDWIPPTRSAASSSDTQVSCDHCLKEVAVKTCLV
CMASFCQEHLRPHIDSPAFQDHPLQPPVRDLLRRKCSRHNRLREMFCPEHGECICHICLV
EHKTCSPTILSQASADLENKLRQKLTIMYSHINGASKALEDVKSKQQNVQESMKRKMLQL
RQEYLEMKAVIDAAETSSTHKLKEEEKRVYGKLDTIYQVLLKKKNEMQNLKAEVELILAK
GDEFEFLEKAAKLQEVSTKPVYIPKIDLDHDLIKGVYQGALDLKSELKLSLKQLQEKKAE
EPCNSGNVGDHAQSTSKPTRPAKKTAPDKKTKKTPGAAGAAGAAGAAGAAGPTSYSSSSN
KLPTFGAPGQATIPDATLKPNAPQPNSAAVKAKVLENFLTMSRTELLEYFVKVVFDYNTA
HNKVALADNYTTASVADGLQHYRSHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGV
GVCYGSMDRQGPESRLGRNPSSWCVEWFNNKISAWHNNMEKTLPSTKATRVGVLLNCDHG
FVIFFAVTEKVYLMYKFKVDFTEALYPAFWVFSAGTTLSICSK
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgtttcctctggccgaggagctgtcgtgctccatctgcctggagcccttc
aaggagcccgtcaccaccccgtgcggccacaatttctgcaggtcatgcctaaatgagacg
tgggtcgtccagggcccgccgtaccggtgcccgcagtgtcgcaccgtgtaccaggtgcgc
ccgcagctgcacaagaacacggtgctgtgcgcagtggtcgagcagtttcttcaggccgag
caggcgcggacccccgtggacgactggatcccgcctacccgctccgccgcatccagctca
gacacccaggtgtcctgcgaccactgcctgaaggaggtcgcggtgaagacgtgcctcgtg
tgcatggcctctttctgccaggagcacttgcggcctcacatcgacagtccggccttccag
gaccaccccctgcagccacccgtccgtgacctgctgcgccgcaaatgttccaggcacaac
cgccttcgcgaaatgttttgtcctgagcacggagagtgcatctgccatatctgcctggta
gagcacaagacctgctcccctacgatcctaagccaggccagcgccgacctggagaacaaa
ctgaggcaaaaactcaccatcatgtacagccacatcaatggagcgagcaaagcactggag
gatgtgaaatccaagcagcagaatgtgcaggagtctatgaagaggaagatgctacagctg
agacaggaatatttggaaatgaaggctgtcatcgatgccgcagagaccagctccacgcac
aagttgaaggaggaggagaagagagtctatggaaagctcgataccatctaccaggttctt
ctcaagaagaagaacgagatgcagaatctgaaggcagaggttgagctcatcctggccaaa
ggggacgagtttgagtttctggagaaagctgcaaaattgcaggaagtgtcaacgaaacca
gtctacatccctaagatagacctggaccatgatttgataaagggggtctaccagggtgca
ttggacctcaagagtgagctgaagctctccctcaagcagctacaggaaaagaaggctgag
gagccctgcaactcaggtaacgtgggagaccatgcgcagtccacatccaaacccacacgc
cctgcgaagaagaccgcaccggacaagaagaccaagaaaacccctggtgctgcgggtgct
gccggtgctgccggtgctgctggtgctgccggtcctacctcctactcttcctcatctaac
aagttgcccacctttggagctcctggacaagcaactatccctgatgccacactcaaaccc
aatgctccacaaccaaactcggcagccgtcaaggctaaggtgttagaaaacttcttaacc
atgtccagaacagagcttctggaatatttcgttaaagtcgtcttcgactacaataccgcc
cacaacaaagtggctctggcagacaactacaccaccgcttccgtggccgacgggctgcag
cactaccggtcccatccccagaggttcacctactgctctcaggtcctggggctgcactgc
tataagaaaggcatccactactgggaggtggagctgcagaagaacaacttctgtggtgta
ggcgtctgctatggcagcatggatcggcagggccccgagagccggctgggccgtaacccc
agctcatggtgtgtggagtggttcaataacaagatctccgcctggcacaacaacatggag
aaaacgctgccctccaccaaggccacgcgagtcggcgtgctactcaactgtgaccatggc
tttgtcattttctttgctgtcaccgaaaaggtgtatctgatgtacaagttcaaggtggac
tttactgaagctctgtacccagccttttgggtgttctctgcgggtaccaccctctctatc
tgctccaagtag

DBGET integrated database retrieval system