KEGG   Rattus norvegicus (rat): 494445
Entry
494445            CDS       T01003                                 

Gene name
Srsf2, Sfrs2
Definition
(RefSeq) serine and arginine rich splicing factor 2
  KO
K12891  splicing factor, arginine/serine-rich 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    494445 (Srsf2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    494445 (Srsf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    494445 (Srsf2)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   SR proteins
    494445 (Srsf2)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_5 RRM_occluded
Other DBs
NCBI-GeneID: 494445
NCBI-ProteinID: NP_001009720
RGD: 1359422
Ensembl: ENSRNOG00000000248
UniProt: Q6PDU1
Position
10q32.2
AA seq 221 aa
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgagctacggccgcccgcctcccgatgtggagggcatgacctccctcaaggtggacaac
ctgacctaccgcacctcacccgacaccctgaggcgcgtcttcgagaagtacgggcgcgtc
ggcgacgtgtacatcccgcgggaccgctacaccaaggagtcccgtggcttcgctttcgtc
cggttccacgacaagcgtgacgccgaagacgccatggacgccatggatggggccgtgctc
gatggccgcgagctgcgggtgcagatggcgcgctacggccgtcctcccgactcgcaccac
agccgccggggaccgccaccccgtaggtacggcggcggcggctacgggcgacggagccgc
agtcctcggcgccgccggcgcagccgatcccggagccggagccgttccaggtcccgaagc
cgctctcgctacagccgctccaagtctcggtcccgcactcgttctcgctcgaggtcgacc
tccaagtccagatctgcccgaagatccaagtccaagtcctcgtcggtctccagatcccgc
tcgaggtccaggtccaggtcgcgatccagaagtcctccgcctgtgtcgaagagagagtcc
aagtctaggtcgcggtccaagagcccacccaagtctccagaagaagagggagcggtttca
tcttaa

DBGET integrated database retrieval system