KEGG   Rattus norvegicus (rat): 494499Help
Entry
494499            CDS       T01003                                 

Gene name
Gsta5, Gsta2
Definition
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494499 (Gsta5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494499 (Gsta5)
   00982 Drug metabolism - cytochrome P450
    494499 (Gsta5)
   00983 Drug metabolism - other enzymes
    494499 (Gsta5)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    494499 (Gsta5)
   05204 Chemical carcinogenesis
    494499 (Gsta5)
   05225 Hepatocellular carcinoma
    494499 (Gsta5)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    494499 (Gsta5)
  09168 Drug resistance
   01524 Platinum drug resistance
    494499 (Gsta5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    494499 (Gsta5)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     494499 (Gsta5)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   494499 (Gsta5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 494499
NCBI-ProteinID: NP_001010921
RGD: 1593189
Ensembl: ENSRNOG00000000201
UniProt: P04903 Q4FZZ3
Position
8q31
AA seq 222 aa AA seqDB search
MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaagccagtgcttcactacttcaatgcccggggcagaatggagtgcatccgg
tggctcctggctgcagcaggagtggagtttgaagagaagcttatacagagtccagaagac
ttggaaaagctaaagaaagacgggaatttgatgtttgaccaagtgcccatggtggagatt
gacgggatgaagctggcacagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagagggtatttta
gatctgactgaaatgattatccaattggtaatatgtcccccagaccaaagagaagccaag
accgccttggcaaaagacaggaccaaaaaccggtacttgcctgcctttgaaaaggtgttg
aagagccatggccaagactaccttgtaggcaacaggctgacccgggtagacatccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctgcagcct
ggcagtcagagaaagccagccatggatgcaaaacaaatcgaagaagcaaggaaggttttc
aagttttag

DBGET integrated database retrieval system