KEGG   Rattus norvegicus (rat): 494499Help
Entry
494499            CDS       T01003                                 

Gene name
Gsta5, Gsta2
Definition
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494499 (Gsta5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494499 (Gsta5)
   00982 Drug metabolism - cytochrome P450
    494499 (Gsta5)
   00983 Drug metabolism - other enzymes
    494499 (Gsta5)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    494499 (Gsta5)
   05204 Chemical carcinogenesis
    494499 (Gsta5)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    494499 (Gsta5)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    494499 (Gsta5)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    494499 (Gsta5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    494499 (Gsta5)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     494499 (Gsta5)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   494499 (Gsta5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 494499
NCBI-ProteinID: NP_001010921
RGD: 1593189
Ensembl: ENSRNOG00000000201
UniProt: P04903 Q4FZZ3
Position
8q31
AA seq 222 aa AA seqDB search
MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaagccagtgcttcactacttcaatgcccggggcagaatggagtgcatccgg
tggctcctggctgcagcaggagtggagtttgaagagaagcttatacagagtccagaagac
ttggaaaagctaaagaaagacgggaatttgatgtttgaccaagtgcccatggtggagatt
gacgggatgaagctggcacagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagagggtatttta
gatctgactgaaatgattatccaattggtaatatgtcccccagaccaaagagaagccaag
accgccttggcaaaagacaggaccaaaaaccggtacttgcctgcctttgaaaaggtgttg
aagagccatggccaagactaccttgtaggcaacaggctgacccgggtagacatccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctgcagcct
ggcagtcagagaaagccagccatggatgcaaaacaaatcgaagaagcaaggaaggttttc
aagttttag

DBGET integrated database retrieval system