KEGG   Rattus norvegicus (rat): 497009Help
Entry
497009            CDS       T01003                                 

Gene name
Naaa, Asahl
Definition
(RefSeq) N-acylethanolamine acid amidase
  KO
K13720  N-acylethanolamine-hydrolysing acid amidase [EC:3.5.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    497009 (Naaa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     497009 (Naaa)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C89
   497009 (Naaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAAA-beta CBAH
Motif
Other DBs
NCBI-GeneID: 497009
NCBI-ProteinID: NP_001010967
RGD: 1307267
Ensembl: ENSRNOG00000002273
UniProt: Q5KTC7
Position
14p22
AA seq 362 aa AA seqDB search
MGTPAIRAACHGAHLALALLLLLSLSDPWLWATAPGTPPLFNVSLDAAPELRWLPMLQHY
DPDFVRAAVAQVIGDRVPQWILEMIGEIVQKVESFLPQPFTSEIRGICDYLNLSLAEGVL
VNLAYEASAFCTSIVAQDSQGRIYHGRNLDYPFGNALRKLTADVQFVKNGQIVFTATTFV
GYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLTESEDFEAAVY
TLAKTPLIADVYYIVGGTSPQEGVVITRDRGGPADIWPLDPLNGAWFRVETNYDHWEPVP
KRDDRRTPAIKALNATGQAHLSLETLFQVLSVFPVYNNYTIYTTVMSAAEPDKYMTMIRN
PS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggggaccccagccatccgggccgcgtgccatggggcacacctggcgctggctctgttg
ctgctgctgtcgctgtcggatccctggctgtgggcgaccgcccctggcactccgcctctc
ttcaacgtcagtctggacgcggccccggagctgcgctggctgccgatgctgcagcactac
gacccagacttcgtgcgcgccgcggtggcgcaggttattggagacagggttccccagtgg
atactagagatgatcggagaaatcgtgcagaaggtggagagcttcctgcctcagcccttc
acctccgagatccgcggcatatgtgactacctcaacctcagcctggcagagggtgtcttg
gtcaacttggcctatgaggcttccgcattctgcaccagtattgtggcccaagactcccaa
ggccgtatttaccatggccggaacctggactatccttttggaaatgccttacgaaagctg
acagcagacgtgcagtttgtaaagaacgggcagattgtattcacagcgaccacttttgtt
ggctatgtaggactgtggacaggtcaaagtccccacaagtttacaatttctggtgatgaa
cgagacaaaggctggtggtgggagaacatgattgctgcgctttccttgggacactcgccc
atcagctggcttatccgcaaaaccctgactgagtccgaagacttcgaagcggccgtttac
acgctggccaagactcccctcattgctgatgtgtattacatcgttgggggtacatcgccc
caggagggagtagtcatcaccagggacagaggtggccccgcggacatttggcctcttgac
cctctgaatggagcgtggttccgagtcgagaccaattatgaccactgggagcctgtgccc
aagagggatgaccgaaggacaccagccatcaaagccctaaatgccacagggcaagctcac
ctcagtctggagaccctcttccaggttttatccgtgtttcctgtttataacaactacaca
atttataccacagtgatgagcgctgctgagcccgacaagtacatgaccatgatcagaaac
ccaagctga

DBGET integrated database retrieval system