KEGG   Rattus norvegicus (rat): 497083
Entry
497083            CDS       T01003                                 

Gene name
Xkr5
Definition
(RefSeq) XK related 5
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: XK-related
Other DBs
NCBI-GeneID: 497083
NCBI-ProteinID: NP_001012228
RGD: 1359335
Ensembl: ENSRNOG00000028636
UniProt: Q5GH58
Position
16q12.5
AA seq 509 aa
MKPGHRTMLWAALLCQQLWRMGMLGARVLTLVLFCRVYRVWVLVVGGAHWLVMTFWLVAQ
QSDIVESTCHWRLFNLLVGAVFILCYINFWDSPSRSRMASFYLVMLLENSILLLLATDFL
QGAPWTSLWTVVGVLSGFLIGCASLVVYYSLLHPKSSDIQENFMRKCCGPIENNKSDSEP
PPRAMVPTGERPDSSSWCQEKSYELTSLDKAPSPGKSTAELRLEEQRSGEDSFFSHHHWL
LLKLALKTGSISKINAALGGDSPGCSCPPRLGSSQHCDLQRKPLFSQQDLPSSPRDPLTL
EKGPEYVGAPKAEMESLETSSYISFASDLEDNATTQKPPATQEDSPKAGTKADLAAQGKD
TDGPLKGKEGQESTTLYFSATMDRTTCHQKGSPVALRTSHLGTLGESRPVQPALPQAVTK
PFPVALANISPIPGRNFCPDAGLPGRAPESSEWEEWEDPAKNPSTQSSLPKVRLRAAEEP
CVTSTPKSESIQRDYNCRDRVKQEVSFFI
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaagccaggccaccgtaccatgctgtgggctgctctcttgtgccagcagctctggagg
atgggcatgctgggtgctcgtgtgctgaccctggttctgttctgcagagtttaccgtgtt
tgggttttggtggtcggaggtgctcactggctggtgatgactttctggcttgtagcccag
cagagcgacattgtggagagcacctgccactggagactgttcaatctgctggtgggggcc
gtgttcatcctctgctacatcaacttctgggacagcccttccagaagtaggatggccagc
ttctacttggtcatgctgctggagaactccatactcttactactggccactgactttctg
cagggagcaccatggaccagcctgtggactgtggtgggggtcttgtctggatttctgatt
gggtgtgcatcattggttgtttattatagcctactacaccctaagtcctcggacatccag
gagaacttcatgaggaaatgctgtggccccatagaaaataacaaatctgactcagagcct
cctcccagagccatggttcccacaggggagaggccagacagctcaagctggtgccaagag
aaaagctatgagctaacaagtctagataaggcccccagcccagggaagagtactgcggag
ttacggctggaggagcagagatctggggaagactctttctttagccaccaccactggctg
ttgctgaaactcgctctcaagacaggaagtatatctaagatcaacgcagccctcggaggt
gacagccctggctgctcctgtccccccaggttggggtcgagtcaacactgtgatctgcag
aggaaacccctgttttcccagcaagacctcccatcctctcctcgtgaccctttgaccttg
gagaaagggcctgagtacgtaggagctccgaaagcagaaatggagtcactggaaacttcg
agctatatctcctttgccagtgacctcgaggacaatgcaacaacccagaagccaccagct
acacaggaggacagtccaaaggctgggaccaaggctgacctggcagctcaggggaaggat
acagatggtcccctgaaggggaaggaaggacaggagagcacaacactgtatttcagtgcc
accatggacaggaccacatgccaccaaaagggcagcccagtagctctgcggacatcccac
ttggggactttgggagaaagcagacctgtgcagcctgcactgcctcaggcagtcactaag
ccctttcctgttgccttggccaacattagtcccattccaggcagaaacttctgccccgat
gcagggctccctggaagagccccagagagttcagagtgggaggagtgggaggaccctgct
aagaacccgagtacacagagctcattgccaaaggtgaggctgagggctgcggaagagccc
tgtgtcacgtctacccctaagtcggagtctatccaaagggactacaactgcagggacagg
gtgaagcaggaggtgagttttttcatctga

DBGET integrated database retrieval system