KEGG   Rattus norvegicus (rat): 497099
Entry
497099            CDS       T01003                                 

Gene name
Xkr9, XRG9
Definition
(RefSeq) XK related 9
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: XK-related
Other DBs
NCBI-GeneID: 497099
NCBI-ProteinID: NP_001012229
RGD: 1359260
Ensembl: ENSRNOG00000040289
UniProt: Q5GH54
Position
5q11
AA seq 373 aa
MKYTICNFMMSVLGIIIYVTDLVADIVLTVRYFYDGQYVFGVLTLSFVLCGTLIVHCFSY
SWLKDDLKKAGGENEHYFLLLHCLQGGVFTRYWFVLRTGYHVVFKHSHRTSNFMEEQTDP
HKEAIDMATDLSMLRLFETYLEGCPQLILQLYAFLERGQANFSQYMVIMVSCCAISWSTV
DYQIALRKSLPDKNLLRGFWPKLTYLFYKLFTLLSWMLSVVLLLFVDVRTVLLLLLFLWT
VGFIWAFINHTQFCNSLSMEFLYRLVVGFILVFTFFNIKGQNTKCPMSCYYTVRVLGTLG
ILTVFWIYPLSIFNSDYFIPISATIVLSLLFGIIFLGVYYGTYHPNINAGTQHDEPDGKA
PQRDCRIRYFLMD
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaatacaccatatgcaattttatgatgtcagttttgggcattataatctatgtaact
gatttagttgcggacattgtcctaactgttaggtacttctatgacggacaatatgttttt
ggtgttttaaccttgagctttgtgctttgtggaacactcatagtccattgttttagctac
tcatggttgaaggacgacttaaagaaagcaggaggagaaaatgaacattattttcttctg
cttcattgcttgcaaggaggagttttcacaaggtattggtttgtcctgagaacaggttac
catgtggttttcaaacacagccacaggacaagtaattttatggaggaacaaacagatcct
cacaaagaagcaatagacatggccaccgacttgagcatgctcagactgtttgagacctac
ctggagggctgcccacaactcatccttcagctctatgcctttctggagcgtggccaggca
aattttagtcaatacatggtcatcatggtttcctgctgtgctatttcttggtcaactgtc
gactatcaaatagctttaagaaaatcattgcctgataaaaatctcctcagaggattctgg
cccaagctcacgtatctcttctacaagttgtttaccttgttatcctggatgctgagtgtt
gtacttctgctctttgtggatgtgaggactgttctgcttctgctcttatttctgtggact
gtaggcttcatatgggcatttataaatcacactcagttttgcaattctctaagtatggag
ttcttatacaggctggtggttggattcatccttgtgttcacgttttttaatatcaagggg
cagaataccaaatgtccaatgtcttgctattacactgtaagggtgcttggcaccctggga
atcttgactgtgttctggatttaccctctctctatttttaactctgactattttatccct
atcagtgccaccatcgttctctctcttctatttgggattatttttcttggtgtgtattat
ggaacttatcacccaaatataaatgcagggacacaacacgacgaacctgatggaaaagca
cctcagagagattgtagaataagatattttctaatggactaa

DBGET integrated database retrieval system