KEGG   Rattus norvegicus (rat): 497197
Entry
497197            CDS       T01003                                 

Gene name
Plcz1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04114  Oocyte meiosis
rno04919  Thyroid hormone signaling pathway
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    497197 (Plcz1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    497197 (Plcz1)
   04070 Phosphatidylinositol signaling system
    497197 (Plcz1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    497197 (Plcz1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    497197 (Plcz1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    497197 (Plcz1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     497197 (Plcz1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    497197 (Plcz1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 EF-hand_7 EF-hand_6 EF-hand_1
Other DBs
NCBI-GeneID: 497197
NCBI-ProteinID: NP_001012234
RGD: 1359567
Ensembl: ENSRNOG00000008514
UniProt: Q5FX52
Position
4
AA seq 645 aa
MESHYELAEARWFMSKIQDYFRGGKISAGITHKLLEKLDFPCHFAHVKRIFKENDRHNQG
RITTEDFRTIYRCIVHREEIVEIFNTYTENRKILPEDSLIEFLTQEQYEMEMDESSSVEI
IQKYEPIAEVKNERQMSIEGFARYMFSSECLLFKETCNTVYQDMNKPLNDYYISSSHNTY
LISDQILGPSDIWGYISALVKGCRCLEIDCWDGAQNEPIVYHGYTLTSKLLFKTVIQAIN
KYAFVTSDYPVVLSLENHCSPGQQEVMTDILQSTFGDFLLSDILDEFPDSLPSPEALKFK
ILVKNKKVGTLSETRERLGTDKRGIALDLEEEIYENEDEDSGKEPETWDDFLSRVKEEQE
ADPSTLSGIADAKKKIRKLRVALALSDLVIYTKAEKFRNFQYSRVYQQFNETTSMGESRA
RKLSKLRAHEFIFHTAAFITRVYPKFTRADSSNFNPQEFWNVGCQMVALNFQTPGLPMDL
QNGKFLDNGGSGYVLKPDFLRDTTLGFNPNEPEGDGHPVTLTIRLISGIQLPVNVPSNTS
DIIVIIEVYGVPNDHMKQQSRAVKNNAFSPRWNETFTFLIQVPELALIRFVVETQGFLSG
NELLGQYTLPVLCMNKGYRRVPLFSKSGANLEPSSLFIYVWYYRE
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggagagccattatgagctcgcagaagcaagatggtttatgtcaaagattcaggattat
tttagaggtggaaaaatcagcgctggaattactcacaaactgctcgagaaacttgatttc
ccatgccattttgctcatgtgaaacgtatttttaaggaaaatgacagacataaccaagga
agaatcaccaccgaagattttagaaccatctatcggtgtattgtacatagagaagagatc
gttgagattttcaacacgtatactgaaaacaggaaaattctccccgaggacagtctgatt
gaatttctaacccaagagcagtatgaaatggagatggatgagtccagttcagtggagatc
atccagaagtacgagcccattgcagaagtaaagaacgagcggcagatgtcaattgaaggt
tttgcaagatacatgttttcttcagaatgtctactgtttaaagagacgtgtaacacagtg
taccaagatatgaataagccactaaatgattactatatttcatcgtctcacaacacatat
ttgatatctgatcaaatattgggaccaagtgacatttggggatatataagtgccctcgtg
aaaggctgccgctgtctggaaattgactgctgggatggagcacaaaatgaacccattgtg
taccatggctacactctcaccagcaagcttctcttcaaaaccgttatccaagcaataaac
aagtacgccttcgtgacgtctgattacccagtggtgctgtccttagagaatcactgctcc
cctggtcaacaggaagtgatgaccgacattctgcagagtacctttggagactttctgctc
tcagacatacttgacgagtttccagacagtttgccatctccagaggcactaaaattcaaa
atattagtgaaaaataagaaagttggaaccttatctgaaacccgcgagaggctggggact
gacaaaaggggcatagcgctagacttggaagaagaaatctatgaaaatgaagacgaagac
tcaggaaaggagccagaaacgtgggatgatttcctgtcacgggttaaggaggagcaggag
gcagacccctcaacgttgagcggaatagcagatgccaagaaaaagatcaggaagctaaga
gtagctctggccttatctgatcttgtcatttataccaaagctgagaagttccgaaacttc
caatattcaagagtctatcagcagtttaatgagaccacttctatgggagagtctcgagct
cgaaaactttcaaaattgagagcccatgagtttattttccacactgcagcgttcatcacc
agagtgtaccccaagttcacgagagcagactcttctaattttaatcctcaagagttttgg
aatgtgggctgtcagatggtggccttgaattttcaaacccctggactgcctatggatttg
caaaacgggaaatttttggataatggaggctctggatatgttttgaagccagactttctt
agagacacaactttgggctttaacccaaatgaaccagaaggagatggccatccggttacc
ctcacgatccgactcatcagtgggatccagttgcctgttaacgtgccctcaaatacatct
gacataatagtgatcatagaagtctacggtgtcccaaacgaccacatgaagcagcagagt
cgtgccgttaagaacaatgcttttagtccaaggtggaatgaaacattcacatttcttatt
caagtgccagaattggcactgatacgtttcgttgttgaaactcaaggcttcctatcggga
aatgaattacttgggcagtacactttacccgttctttgcatgaacaaaggttatcgtcgc
gttcctctgttttccaaatccggtgcgaaccttgaaccttcctctctgtttatttacgtt
tggtactacagagagtga

DBGET integrated database retrieval system