KEGG   Rattus norvegicus (rat): 497761
Entry
497761            CDS       T01003                                 

Gene name
Cd2, CD2R, LFA-2, LFA2, OX-34, OX34
Definition
(RefSeq) Cd2 molecule
  KO
K06449  T-cell surface glycoprotein CD2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    497761 (Cd2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    497761 (Cd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    497761 (Cd2)
   04090 CD molecules [BR:rno04090]
    497761 (Cd2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   497761 (Cd2)
CD molecules [BR:rno04090]
 Proteins
  497761 (Cd2)
SSDB
Motif
Pfam: C2-set V-set Ig_3 Ig_2 I-set Herpes_gE YhzD WBP-1
Other DBs
NCBI-GeneID: 497761
NCBI-ProteinID: NP_036962
RGD: 2297
Ensembl: ENSRNOG00000015821
UniProt: P08921
Structure
PDB: 
1A64 1CDC 1A6P 1A7B 1T6W

Position
2q34
AA seq 344 aa
MRCKFLGSFFLLFSLSSKGADCRDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTL
VAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRIL
EMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCK
AVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGE
ELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNRE
HQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagatgtaaattcctagggagtttctttctgctcttcagcctgtccagcaaaggagca
gactgcagagacagtgggaccgtctggggtgccctgggtcatggcatcaacctgaacatc
cctaactttcaaatgactgatgatattgatgaggtgcgatgggagagggggagcaccctg
gttgccgagtttaaaaggaagatgaagccttttttgaaatcgggagcatttgagatctta
gcaaatggagacttgaagataaagaatctgacaagagatgacagtggcacctataatgta
acggtatacagcacaaatgggacacgtatcctggacaaggcactggacttgaggattcta
gagatggtctcaaagccgatgatctactgggagtgcagcaacgcaaccctgacctgtgag
gtcttggaaggaacagatgttgaactaaagctgtaccaaggaaaggagcatctcaggagc
ctccgtcagaagaccatgagttaccagtggaccaacctgagagcaccgtttaagtgcaag
gcggtaaacagggtcagccaggagtctgagatggaagttgtcaactgtccagagaaaggt
ctgcccctctatctcatagtgggggtcagtgcaggaggactcctcttggtgttctttggg
gcgctgtttattttctgtatctgcaagaggaaaaaacggaacaggaggagaaaaggtgaa
gagctggagataaaagcttccagaatgagcactgtggaaaggggacccaagccacactca
acccaggcctcagcaccagcatcacagaatccagtggcttcccaagctcctcctccacct
ggccatcatctccagacacctggccatcgtcccctgcctccaagccaccgtaaccgtgag
caccagccgaagaagagacctcctccatcaggcacacaggttcaccagcagaaaggccct
cctttgcccagaccccgagttcagccaaagcctccctgtgggagtggagatgtttcgttg
ccaccccctaattaa

DBGET integrated database retrieval system