KEGG   Rattus norvegicus (rat): 497778Help
Entry
497778            CDS       T01003                                 

Gene name
Dut, Dutp, PIP4
Definition
(RefSeq) deoxyuridine triphosphatase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    497778 (Dut)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    497778 (Dut)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    497778 (Dut)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     497778 (Dut)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    497778 (Dut)
 Prokaryotic type
    497778 (Dut)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dUTPase
Motif
Other DBs
NCBI-GeneID: 497778
NCBI-ProteinID: NP_446044
RGD: 620849
Ensembl: ENSRNOG00000007221
UniProt: P70583
Position
3q36
AA seq 205 aa AA seqDB search
MPLLCALLRSRLQPSLLRSLTLTSAQSLSCGGSRGVRTWSARTGPGACADPAVSVSKRAR
AEDDASLRFVRLSEHATAPTRGSARAAGYDLYSAYDYTIPSMEKALVKTDIQIAVPSGCY
GRVAPRSGLAVKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERILY
PDLEEVQTLDNTERGSGGFGSTGKN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcttgtgcgcgctgctgcgcagccgactccaaccttctctgctccgctcgctt
acgctcacgtccgcgcaaagcctaagctgcggcggaagcagaggagtccggacctggagc
gcgcggaccggacccggagcgtgcgctgaccctgcggtctctgtctctaagagggctcga
gcggaagatgacgcttctctgcgtttcgtgcggctctcggagcacgctacggctcccacc
cgcgggtccgcgcgcgctgcaggctacgacctgtacagtgcctatgattatacaattcca
tccatggagaaagcccttgtgaagacagacattcagatagctgttccttctgggtgctat
ggaagagtggctccacgttctggcttggctgtaaagcacttcatagatgtaggagccggt
gtcatagatgaagattatagaggaaatgtcggcgtcgtgctgttcaattttggaaaagag
aagttcgaggtgaaaaaaggtgaccggatcgcgcagctcatttgtgagcggattctttat
ccagacttagaggaggtgcaaacactggataacactgagagaggctcaggaggcttcggc
tccacgggaaagaattaa

DBGET integrated database retrieval system