KEGG   Rattus norvegicus (rat): 497815Help
Entry
497815            CDS       T01003                                 

Gene name
Nrcam
Definition
(RefSeq) neuronal cell adhesion molecule
  KO
K06756  neuronal cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    497815 (Nrcam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY C2-set_2 Ig_6 V-set Ig_C17orf99 Ig_5 Pur_ac_phosph_N SIT fn3_2
Motif
Other DBs
NCBI-GeneID: 497815
NCBI-ProteinID: NP_037282
RGD: 3209
Ensembl: ENSRNOG00000004067
UniProt: Q6PW34
Position
6q21
AA seq 1299 aa AA seqDB search
MPKKKPLSAGRAPLFLFLCQMISALDVPLDPKLLDDLVQPPTITQQSPKDYIIDPRENIV
IQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAETYEGVYQCTA
RNERGAAVSNNIVVRPSRSPLWTKERLEPIILRSGQSLVLPCRPPIGLPPAIIFWMDNSF
QRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISLKVISVDELN
DTIAANLSDTEFYGAKSSKERPPTFLTPEGNESHKEELRGNVLSLECIAEGLPTPVIYWI
KEDGTLPVNRTFYRNFKKTLQIIHVSEADSGNYQCIAKNALGAVHHTISVTVKAAPYWIV
APHNLVLSPGENGTLICRANGNPKPRISWLTNGVPVEIALDDPSRKIDGDTIMFSNVQES
SSAVYQCNASNKYGYLLANAFVNVLAEPPRILTSANTLYQVIANRPALLDCAFFGSPMPT
IEWFKGTKGSALHEDIYVLHDNGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDP
TRFIKQPEYAVVQRGSKVSFECKVKHDHTLIPTILWLKDNGELPNDERFSVDKDHLVVSD
VKDEDGGTYTCAANTTLDSVSASAVLRVVAPTPTPAPIYDVPNPPFDLELTNQLDKSVQL
TWTPGDDNNSPITKFIIEYEDAMHEAGLWRHQAEVSGTQTTAQLKLSPYVNYSFRVMAEN
SIGRSVPSEASEQYLTKAAEPDQNPTAVEGLGTEPDNLVITWKPLNGFQSNGPGLQYKVS
WRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVGFAPEPAAVMGHSGEDLP
MVAPGNVRVSVVNSTLAEAHWDPVPPKSVRGHLQGYRIYYWKAQSSSKRNRRHIEKKILT
FQGSKTHGMLPGLQPYSHYVLNVRVVNGKGEGPASADRGFHTPEGVPSAPSSLKIVNPTL
DSLTLEWDPPSHPNGILTEYILKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYK
FYFYAQTSVGSGSQITEEAITTVDEAGILPPDVGAGKVRAVSPRIGNVTAAAAETYANIS
WEYEGPEHVKFYVEYGVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFV
SSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPVKEKED
AHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQ
FNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaagaagcccttgtctgcaggcagagcgcccctgtttctcttcctgtgccag
atgatcagcgctctggatgttcctcttgatccaaagctccttgatgacttggtacagcct
ccaactatcactcaacagtcaccaaaagactacatcattgacccacgggagaatattgta
atccaatgtgaggccaaagggaaacctcctccaagcttttcctggactcgtaacggaaca
cattttgacatagacaaagaccctctggtcactatgaagcctggctcaggaacccttgtc
atcaacatcatgagtgaaggaaaggcggagacctatgaaggggtttaccagtgcactgca
aggaatgagcgcggagctgctgtctccaataacattgttgtccgcccctctaggtcaccc
ttgtggaccaaggaaagacttgaaccaataatcctccgaagtggtcagtcactagtacta
ccatgtaggcctccaattggattaccaccggccataatattttggatggataactccttt
caaagactgccacagagtgagcgggtttcccaaggactgaatggagacctttacttctcc
aatgtcctcccagaggacacccgtgaggactacatctgctatgccagatttaatcacact
caaacaattcaacagaaacaacctatttctctgaaggtgatttcagtggatgaattgaat
gacactatagctgctaatttgagtgacactgagttttatggtgctaaatctagtaaagag
aggccaccaacatttctaactccagagggcaatgaaagtcacaaggaagaattaagagga
aacgtgctttccctggagtgcattgcagaaggcctacctactccagttatttactggatc
aaggaagatggaacgcttcctgtcaaccggacgttttatcggaactttaagaaaaccttg
cagatcattcatgtctctgaagcagactctggaaattatcagtgcatagcaaaaaacgca
ttgggagccgtccatcataccatttctgtcacagttaaagcggctccctactggattgtt
gcacctcacaacctcgtgctttccccaggggagaatgggaccctcatctgcagagctaac
ggcaacccaaaacccagaattagctggttaacaaatggagtcccagtagaaattgctctc
gatgaccccagccgaaaaatcgatggtgataccattatgttttcaaatgttcaagaaagc
tcaagtgcggtttatcagtgcaatgcctctaacaaatatggatatttactagcaaatgca
tttgtaaatgtgctcgctgaaccacctcggattcttacctcagcaaacacactgtaccag
gtcattgcaaaccggcctgctttgctggactgtgccttctttgggtctcctatgcctacc
attgagtggtttaaaggaactaaaggaagcgctcttcacgaagacatttatgttttacat
gataacggaacgctagaaattcctgtggcccaaaaggatagtacagggacatatacttgt
gtcgcaaggaataaattagggatggcaaagaatgaagttcacttggaaatcaaagatcca
accaggttcattaaacaacctgaatatgcagtcgttcagagggggagcaaggtttccttt
gaatgcaaagtgaaacacgaccacaccttaatccccaccattctgtggctgaaggacaat
ggagagctgcccaatgatgaaaggttctctgtcgacaaggaccatctggtggtctctgac
gtaaaggatgaagatggtgggacctacacatgtgcagccaacacaacgctggacagtgtt
tcagccagcgccgtgctcagggtggtcgctcctactccaactccagcccccatttacgat
gtcccgaatcctccctttgatttagaattgaccaatcaacttgacaaaagtgttcagctg
acatggaccccaggcgatgacaacaatagtcccattacaaaattcatcatcgagtatgaa
gatgcaatgcatgaggcagggctgtggcgccaccaggcggaagtttctggaacgcagacc
acagcccagctgaagctgtctccctatgtgaactactccttccgagtcatggcggagaac
agcatcgggaggagtgtgccaagcgaggcatcggagcagtatcttacaaaggccgcggaa
ccagaccagaatcccacggctgtggaaggactagggacagagccggacaacttggtgatc
acatggaagcccctgaatggttttcaatcgaatgggcccggcctccagtacaaagtgagc
tggcgtcagaaagatggtgacgatgaatggacgtctgtggttgtggccaatgtatccaaa
tacattgtttctggcacaccaacttttgtcccatacctgataaaagttcaagccctgaat
gatgtgggctttgctccagagccagctgcagtcatgggacattccggagaagaccttcca
atggtggctcctggaaatgtgcgtgtcagtgtggtgaacagcaccttggcagaggcacac
tgggaccctgtacctcccaagagtgtccgaggacacttacaaggctaccggatttactac
tggaaggctcagagctcatctaaaagaaacagacgccacattgagaagaagatcctcacc
ttccagggcagcaagactcacggcatgctgccagggctgcaaccttacagtcactatgtt
ctcaatgtccgagtggtcaatgggaaaggggagggcccagccagcgccgacagaggcttc
catactccagagggagtccctagtgctccctcatctttgaaaattgttaatcctacactg
gactctctcactttggaatgggaccctccaagccacccaaatggtatcctgactgaatac
atcttaaaatatcagccaattaatagcacacacgaactaggccctctggtagatttaaaa
attcctgccaacaagacacgctggactttgaaaaatttaaatttcagcactcggtacaag
ttctacttctatgcacaaacatcagtgggatcgggcagtcagatcacagaggaagcaata
acaactgtggacgaagctggtattcttccacctgatgtaggtgcaggcaaagtccgtgca
gtaagtcccaggatcggcaatgtcactgctgcagctgctgagacgtatgccaatatcagt
tgggaatatgagggaccagagcatgtgaagttttatgttgaatatggtgtagcaggcagc
aaagaagaatggaggaaagagattgtaaatggttctcggagcttctttgggttaaagggt
ctaatgccaggaacagcatacaaagtccgagttggtgctgagggggactctggttttgtg
agttcagaggatgtgtttgagacaggaccagcaatggcaagtcggcaagtggatattgcg
acccaaggctggttcataggtctaatgtgtgctgttgccctcctcatcttaattttgcta
atcgtttgcttcatcagaagaaacaaaggtggtaaatatccagttaaagaaaaggaggat
gctcacgcagaccctgaaatccagcccatgaaggaggatgacggaacgtttggagaatat
agtgatgcagaagatcacaagcctttgaaaaaaggaagtcgaacaccttcagacaggact
gtgaaaaaagaagatagtgatgacagcctggttgactatggcgagggggtgaatggccaa
ttcaatgaggatggctcctttatcggacaatacagtggtaagaaagagaaagaaccagca
gagggaaatgaaagctcagaggccccttctcctgtcaacgcaatgaactcctttgtttaa

DBGET integrated database retrieval system