KEGG   Rattus norvegicus (rat): 497859Help
Entry
497859            CDS       T01003                                 

Gene name
Atf7ip2
Definition
(RefSeq) activating transcription factor 7 interacting protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ATF7IP_BD DUF3480
Motif
Other DBs
NCBI-GeneID: 497859
NCBI-ProteinID: NP_001017471
RGD: 1583744
Ensembl: ENSRNOG00000025522
UniProt: Q5XIL7
Position
10q11
AA seq 393 aa AA seqDB search
MESPDRKRRKVLKAKKTMPTSCRKQMEILNQSKNVEAPKTTVVTNIPNGHNQKMFSENKE
NVKVMKTSEQINENACEALERHTALLEQVKHWIRQEICTINCNLFDKKLNELNERIGKTQ
CRSKHEAIAGELFIKIRRLQKRIKTVLSSQGNCLEPNTLPSNTVCKVTDSVNLSVTQRSV
KSQSKRMSSVNHTPFNSSEKASRKINLPSACVEFVSESNDDVMLISVENPNLTTPIASDP
TEIRKNTSRNVSSSPNARSEVVPVEKKFDFVIDLTREGLSSYSIGPPSSRLHHLRIAPSA
EDQAFNTGAFGDHSNSRVQQIGTKPSTRRKKIPVKEKENLQQENTTRRGDGGGYSRVQKS
ELTGTRPPGMSSSSSDNRKGFNTSFLNQNRTLP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtccagacagaaaaagacggaaggttttaaaggccaagaagacaatgcctaca
agttgccggaagcagatggagatcctgaaccagtcaaagaatgttgaagctccaaaaaca
acagttgtgactaatattccaaatggccataatcagaagatgttttcagaaaacaaagaa
aatgttaaggtcatgaaaacttcagagcaaattaatgaaaatgcttgtgaggctctggaa
aggcatacagcactgctagaacaggttaaacattggattcgacaggaaatctgcacgata
aactgtaatttatttgataaaaaactgaatgaattgaatgaacgcattgggaagacccag
tgcagaagtaagcatgaagcaatagctggtgaactctttataaaaataagaagacttcaa
aaacgtatcaaaaccgtattatcatctcaaggaaattgtttggaaccaaacacattaccc
agtaacacagtttgtaaggttacagattctgtgaatttgagtgtgacccaaaggtcagtt
aaaagtcaaagtaaaagaatgtcttctgtgaaccatacgccttttaactcttcagaaaaa
gcaagtagaaagattaatttgccatcagcttgtgttgagtttgtttctgaaagtaacgat
gatgttatgttgatttctgtggaaaatcctaatttgacaactccaattgcatcagatcca
acagaaattagaaaaaatacatcaagaaatgtcagcagttctcctaatgccaggagtgaa
gttgtgcctgtagagaagaaatttgactttgttattgacctgacaagagaaggcctgtcc
agctacagcataggccctccttcatcaagattacaccatctccgaatagcaccatcagct
gaggaccaagccttcaacacaggggcctttggggaccattccaattccagagtgcaacag
atagggaccaagccctccaccaggagaaagaagattcctgtgaaagaaaaagaaaatctt
cagcaagagaacaccactagaagaggagatggaggaggctacagcagggtacagaagtca
gagcttacaggaacccgacctccaggaatgagttcctccagcagtgacaacaggaaaggt
ttcaacacctcctttctgaatcagaaccggaccttaccttga

DBGET integrated database retrieval system