KEGG   Rattus norvegicus (rat): 497860Help
Entry
497860            CDS       T01003                                 

Gene name
Rpl39l
Definition
(RefSeq) ribosomal protein L39-like
  KO
K02924  large subunit ribosomal protein L39e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    497860 (Rpl39l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    497860 (Rpl39l)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    497860 (Rpl39l)
  Archaea
    497860 (Rpl39l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L39 DUF3485
Motif
Other DBs
NCBI-GeneID: 497860
NCBI-ProteinID: NP_001182400
RGD: 1561345
Ensembl: ENSRNOG00000032300
UniProt: Q3ZB89
Position
10q11
AA seq 51 aa AA seqDB search
MASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcacaagaccttcagaatcaagcgcttcctggctaagaaacaaaagcaaaat
cgtccgattccacaatggattcagatgaaaaccggcaataaaatcatgtacaactccaag
cggagacactggagacgaaccaaattgggtctataa

DBGET integrated database retrieval system