KEGG   Rattus norvegicus (rat): 497863Help
Entry
497863            CDS       T01003                                 

Gene name
Tmem186
Definition
(RefSeq) transmembrane protein 186
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM223
Motif
Other DBs
NCBI-GeneID: 497863
NCBI-ProteinID: NP_001020927
RGD: 1561167
Ensembl: ENSRNOG00000027087
UniProt: Q4KLZ1
Position
10q12
AA seq 216 aa AA seqDB search
MAFLLRAVPRLQGPAAWRRPLQQLWCRAGQGDSIRWVGSRSPPSQEKPPGTETEKFHTIY
RFNAIRALGFLSRLKLAQTAVTVVALPPGFYCYSQGLMTLSSLGLMSGIASFALVMLCWM
SHFFRRLVGILYVNESGTLLRVAHLTFWGWRQDTYCAVSDMIPLSESEERVQDVFVRIQQ
YSGKQTFYLTLRYGRILDRDRFSQVFGTLATLKNSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctccttcgagctgtgccaaggctgcaggggcccgctgcatggaggaggcct
ctacagcaactgtggtgccgtgctgggcagggggattccataaggtgggtggggagcagg
tctcccccctcacaggagaagccaccaggcacagagactgaaaaattccacacaatctac
cgcttcaatgccatcagagcacttgggttcctgtctcggctgaagttggcacagacagct
gtgactgtggtggccctgcccccaggcttctactgctactcacaaggcctcatgaccctc
agctcactgggccttatgagtgggattgccagctttgccctggtcatgctgtgctggatg
agccacttcttccggagactggtaggcatcctctatgtgaatgagtcaggtaccttgctt
cgagtggcccacctgaccttctggggctggcgacaggacacatactgtgccgtgtcagac
atgatacccctgtcagaatccgaggaacgggtccaggatgtgttcgtgcgtatccagcag
tacagtggcaagcagaccttctacctcaccctacgctatggccgaatcctggacagggat
cgtttctcacaagtattcggaaccctggccacactcaagaacagcaagtag

DBGET integrated database retrieval system